🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS CoA Structure
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

TAS2R40

DescrizioneTaste receptor type 2 member 40

Gene and Protein Information

Gene ID259286
Uniprot Accession IDs P59535 A4D2I2 Q645W6 T2R40
Ensembl ID ENSP00000386210
Symbol GPR60 GPR60 T2R40 T2R58
FamilyBelongs to the G-protein coupled receptor T2R family.
Sequence
MATVNTDATDKDISKFKVTFTLVVSGIECITGILGSGFITAIYGAEWARGKTLPTGDRIMLMLSFSRLLLQIWMMLENIFSLLFRIVYNQNSVYILFKVITVFLNHSNLWFAAWLKVFYCLRIANFNHPLFFLMKRKIIVLMPWLLRLSVLVSLSFSFPLSRDVFNVYVNSSIPIPSSNSTEKKYFSETNMVNLVFFYNMGIFVPLIMFILAATLLILSLKRHTLHMGSNATGSRDPSMKAHIGAIKATSYFLILYIFNAIALFLSTSNIFDTYSSWNILCKIIMAAYPAGHSVQLILGNPGLRRAWKRFQHQVPLYLKGQTL
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp472611TAS2R40taste 2 receptor member 409598VGNC:8774Inparanoid, OMA, EggNOG
Macaque706077TAS2R40taste 2 receptor member 409544Inparanoid, OMA, EggNOG
Mouse387515Tas2r144taste receptor, type 2, member 14410090MGI:2681312Inparanoid, OMA, EggNOG
Rat500101Tas2r144taste receptor, type 2, member 14410116RGD:1562314Inparanoid, OMA, EggNOG
Dog608842TAS2R40taste 2 receptor member 409615VGNC:47119Inparanoid, OMA, EggNOG
Horse100050534TAS2R40taste 2 receptor member 409796VGNC:23883Inparanoid, OMA, EggNOG
Cow785133TAS2R40taste 2 receptor member 409913VGNC:35614OMA, EggNOG
Pig106508195TAS2R40taste 2 receptor member 409823OMA, EggNOG
Opossum664679T2R40bitter taste receptor Modo-T2R4013616Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Taste 2 receptor    /    Taste receptor type 2 member 40

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.