🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS CoA Structure
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

TAS2R41

DescrizioneTaste receptor type 2 member 41

Gene and Protein Information

Gene ID259287
Uniprot Accession IDs P59536 P59550 Q495I2 Q50KJ5 Q50KJ6 Q50KJ7 Q645W7 T2R41
Ensembl ID ENSP00000386201
Symbol T2R41 T2R59
FamilyBelongs to the G-protein coupled receptor T2R family.
Sequence
MQAALTAFFVLLFSLLSLLGIAANGFIVLVLGREWLRYGRLLPLDMILISLGASRFCLQLVGTVHNFYYSAQKVEYSGGLGRQFFHLHWHFLNSATFWFCSWLSVLFCVKIANITHSTFLWLKWRFPGWVPWLLLGSVLISFIITLLFFWVNYPVYQEFLIRKFSGNMTYKWNTRIETYYFPSLKLVIWSIPFSVFLVSIMLLINSLRRHTQRMQHNGHSLQDPSTQAHTRALKSLISFLILYALSFLSLIIDAAKFISMQNDFYWPWQIAVYLCISVHPFILIFSNLKLRSVFSQLLLLARGFWVA
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp472562TAS2R41taste 2 receptor member 419598VGNC:8775Inparanoid, OMA, EggNOG
Mouse387353Tas2r126taste receptor, type 2, member 12610090MGI:2681273Inparanoid, OMA, EggNOG
Rat246219Tas2r126taste receptor, type 2, member 12610116RGD:727853Inparanoid, OMA, EggNOG
Dog482734TAS2R41taste 2 receptor member 419615VGNC:49729Inparanoid, OMA, EggNOG
Pig100524003TAS2R41taste 2 receptor member 419823OMA, EggNOG
Opossum664677T2R41bitter taste receptor Modo-T2R4113616Inparanoid, OMA, EggNOG
Xenopus100335065t2r13bitter taste receptor 138364OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Taste 2 receptor    /    Taste receptor type 2 member 41

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.