🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

SUPT4H1

DescrizioneTranscription elongation factor SPT4

Gene and Protein Information

Gene ID6827
Uniprot Accession IDs P63272 B2R4X8 D3DTZ4 Q16550 Q62387 Q6ZP89 hSPT4
Ensembl ID ENSP00000225504
Symbol SPT4H SUPT4H SPT4 SPT4H SUPT4H Supt4a
FamilyBelongs to the SPT4 family.
Sequence
MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp468422SUPT4H1SPT4 homolog, DSIF elongation factor subunit9598VGNC:9668OMA, EggNOG
Mouse20922Supt4asuppressor of Ty 4A10090MGI:107416Inparanoid, OMA
Rat287608Supt4h1SPT4 homolog, DSIF elongation factor subunit10116RGD:1306372Inparanoid, OMA
Dog609757SUPT4H1SPT4 homolog, DSIF elongation factor subunit9615VGNC:46991Inparanoid, OMA, EggNOG
Horse100056960SUPT4H1SPT4 homolog, DSIF elongation factor subunit9796VGNC:23765Inparanoid, OMA, EggNOG
Cow616425SUPT4H1SPT4 homolog, DSIF elongation factor subunit9913VGNC:35480Inparanoid, OMA, EggNOG
Opossum100022141LOC100022141transcription elongation factor SPT4-A-like13616Inparanoid, OMA, EggNOG
Chicken417470SUPT4H1SPT4 homolog, DSIF elongation factor subunit9031CGNC:692Inparanoid, OMA, EggNOG
Xenopus549433supt4h1SPT4 homolog, DSIF elongation factor subunit8364XB-GENE-977391Inparanoid, OMA, EggNOG
Zebrafish436782supt4h1SPT4 homolog, DSIF elongation factor subunit7955ZDB-GENE-040718-214Inparanoid, OMA
C. elegans175172spt-4Transcription elongation factor SPT46239Inparanoid, OMA, EggNOG
Fruitfly36387spt4CG12372 gene product from transcript CG12372-RA7227FBgn0028683Inparanoid, EggNOG
S.cerevisiae852955SPT4transcription elongation factor SPT44932S000003295Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    chromatin/chromatin-binding protein    /    Transcription elongation factor SPT4
protein    /    nucleic acid binding    /    transcription factor    /    Transcription elongation factor SPT4
DTO Classes
protein    /    Nucleic acid binding    /    DNA binding protein    /    Chromatin/chromatin-binding protein    /    Transcription elongation factor SPT4

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.