CD40

DescrizioneTumor necrosis factor receptor superfamily member 5

Gene and Protein Information

Gene ID958
Uniprot Accession IDs P25942 E1P5S9 Q53GN5 Q5JY15 Q5U007 Q7M4Q8 Q86YK5 Q9BYU0
Ensembl ID ENSP00000361359
Symbol TNFRSF5 p50 Bp50 CDW40 TNFRSF5
Sequence
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Macaque707749CD40CD40 molecule9544OMA, EggNOG
Mouse21939Cd40CD40 antigen10090MGI:88336Inparanoid, OMA, EggNOG
Rat171369Cd40CD40 molecule10116RGD:619830Inparanoid, OMA, EggNOG
Dog403469CD40CD40 molecule9615VGNC:38958Inparanoid, OMA, EggNOG
Horse100034049CD40CD40 molecule9796VGNC:16268Inparanoid, OMA, EggNOG
Cow286849CD40CD40 molecule9913VGNC:27033Inparanoid, OMA, EggNOG
Opossum100022240CD40CD40 molecule13616Inparanoid, EggNOG
Chicken395385CD40CD40 molecule9031CGNC:5292Inparanoid, OMA
Xenopus100270675cd40CD40 molecule, TNF receptor superfamily member 58364XB-GENE-5963241Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.