🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

TOMM34

DescrizioneMitochondrial import receptor subunit TOM34

Gene and Protein Information

Gene ID10953
Uniprot Accession IDs Q15785 Q53GH9 Q6IBN7 Q9NTZ3 hTom34
Ensembl ID ENSP00000361900
Symbol URCC3 TOM34 URCC3 HTOM34P
FamilyBelongs to the Tom34 family.
Sequence
MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp458274TOMM34translocase of outer mitochondrial membrane 349598VGNC:6285Inparanoid, OMA, EggNOG
Mouse67145Tomm34translocase of outer mitochondrial membrane 3410090MGI:1914395Inparanoid, OMA, EggNOG
Rat311621Tomm34translocase of outer mitochondrial membrane 3410116RGD:1309029Inparanoid, OMA
Dog477239TOMM34translocase of outer mitochondrial membrane 349615VGNC:49628Inparanoid, OMA, EggNOG
Horse100070847TOMM34translocase of outer mitochondrial membrane 349796VGNC:50511Inparanoid, OMA, EggNOG
Cow508142TOMM34translocase of outer mitochondrial membrane 349913VGNC:49135Inparanoid, OMA, EggNOG
Pig100157194TOMM34translocase of outer mitochondrial membrane 349823Inparanoid, OMA, EggNOG
OpossumTOMM34translocase of outer mitochondrial membrane 34 [Source:HGNC Symbol;Acc:HGNC:15746]13616Inparanoid, EggNOG
Chicken419188TOMM34translocase of outer mitochondrial membrane 349031CGNC:3015Inparanoid, OMA
Anole lizard100561170tomm34translocase of outer mitochondrial membrane 3428377Inparanoid, OMA, EggNOG
Zebrafish323361tomm34translocase of outer mitochondrial membrane 347955ZDB-GENE-030131-2081Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.