SMAD3

DescrizioneMothers against decapentaplegic homolog 3

Gene and Protein Information

Gene ID4088
Uniprot Accession IDs P84022 A8K4B6 B7Z4Z5 B7Z6M9 B7Z9Q2 F5H383 O09064 O09144 O14510 O35273 Q92940 Q93002 Q9GKR4 MAD homolog 3
Ensembl ID ENSP00000332973
Symbol MADH3 LDS3 LDS1C MADH3 JV15-2 HSPC193 HsT17436
FamilyBelongs to the dwarfin/SMAD family.
Sequence
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp748161SMAD3SMAD family member 39598VGNC:1877OMA, EggNOG
Macaque711355SMAD3SMAD family member 39544Inparanoid, OMA, EggNOG
Mouse17127Smad3SMAD family member 310090MGI:1201674Inparanoid, OMA
Rat25631Smad3SMAD family member 310116RGD:3032Inparanoid, OMA
Pig397260SMAD3SMAD family member 39823Inparanoid, OMA
Zebrafish58092smad3aSMAD family member 3a7955ZDB-GENE-000509-3Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.