🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

GFRAL

DescrizioneGDNF family receptor alpha-like

Gene and Protein Information

Gene ID389400
Uniprot Accession IDs Q6UXV0 Q5VTF6
Ensembl ID ENSP00000343636
Symbol C6orf144 GRAL UNQ9356 C6orf144 bA360D14.1
FamilyBelongs to the GDNFR family.
Sequence
MIVFIFLAMGLSLENEYTSQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGEVIYAAMCMTVTCGILLLVMVKLRTSRISSKARDPSSIQIPGEL
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp743306GFRALGDNF family receptor alpha like9598VGNC:2838OMA, EggNOG
Mouse404194GfralGDNF family receptor alpha like10090MGI:3607786Inparanoid, OMA, EggNOG
Rat501023GfralGDNF family receptor alpha like10116RGD:1565220Inparanoid, OMA, EggNOG
Dog481851GFRALGDNF family receptor alpha like9615VGNC:41192Inparanoid, OMA, EggNOG
Horse100069686GFRALGDNF family receptor alpha like9796VGNC:18319Inparanoid, OMA, EggNOG
Cow531956GFRALGDNF family receptor alpha like9913VGNC:53972Inparanoid, OMA, EggNOG
Pig100521501GFRALGDNF family receptor alpha like9823Inparanoid, OMA, EggNOG
Chicken421887GFRALGDNF family receptor alpha like9031CGNC:12187OMA, EggNOG
Anole lizardGFRALGDNF family receptor alpha like [Source:HGNC Symbol;Acc:HGNC:32789]28377Inparanoid, OMA, EggNOG
Zebrafish561326gfralGDNF family receptor alpha like7955ZDB-GENE-110607-2OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.