🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

TPSG1

DescrizioneTryptase gamma

Gene and Protein Information

Gene ID25823
Uniprot Accession IDs Q9NRR2 Q96RZ8 Q9C015 Q9NRQ8 Q9UBB2
Ensembl ID ENSP00000234798
Symbol PRSS31 TMT TMT trpA PRSS31
FamilyBelongs to the peptidase S1 family. Tryptase subfamily.
Sequence
MALGACGLLLLLAVPGVSLRTLQPGCGRPQVSDAGGRIVGGHAAPAGAWPWQASLRLRRMHVCGGSLLSPQWVLTAAHCFSGSLNSSDYQVHLGELEITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELSVPVTLSSRILPVCLPEASDDFCPGIRCWVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCARGPGDACQDDSGGPLVCQVNGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWIRRHITASGGSESGYPRLPLLAGLFLPGLFLLLVSCVLLAKCLLHPSADGTPFPAPD
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Macaque100425751TPSG1tryptase gamma 19544Inparanoid, OMA, EggNOG
Mouse26945Tpsg1tryptase gamma 110090MGI:1349391Inparanoid, OMA, EggNOG
Rat302990Tpsg1tryptase gamma 110116RGD:631355Inparanoid, OMA, EggNOG
Horse100067538TPSG1tryptase gamma 19796VGNC:24447Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    peptide hormone    /    Tryptase gamma
protein    /    calcium-binding protein    /    serine protease    /    Tryptase gamma
protein    /    calcium-binding protein    /    protease inhibitor    /    Tryptase gamma
protein    /    calcium-binding protein    /    calmodulin    /    Tryptase gamma
protein    /    calcium-binding protein    /    annexin    /    Tryptase gamma
protein    /    calcium-binding protein    /    receptor    /    Tryptase gamma
DTO Classes
protein    /    Enzyme    /    Protease    /    Serine protease    /    Tryptase gamma

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.