🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

TEX264

DescrizioneTestis-expressed protein 264

Gene and Protein Information

Gene ID51368
Uniprot Accession IDs Q9Y6I9 B3KN87 Q9UKD7
Ensembl ID ENSP00000396628
Symbol ZSIG11 ZSIG11
Sequence
MSDLLLLGLIGGLTLLLLLTLLAFAGYSGLLAGVEVSAGSPPIRNVTVAYKFHMGLYGETGRLFTESCSISPKLRSIAVYYDNPHMVPPDKCRCAVGSILSEGEESPSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYVPEMKETEWKWRGLVEAIDTQVDGTGADTMSDTSSVSLEVSPGSRETSAATLSPGASSRGWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTKWLWEPTAPEKGKE
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Macaque700350TEX264testis expressed 2649544Inparanoid, OMA, EggNOG
Mouse21767Tex264testis expressed gene 26410090MGI:1096570Inparanoid, OMA, EggNOG
Rat300988Tex264testis expressed 26410116RGD:1359353Inparanoid, OMA, EggNOG
Dog476607TEX264testis expressed 2649615VGNC:47271Inparanoid, OMA, EggNOG
Horse100147234TEX264testis expressed 2649796VGNC:24017Inparanoid, OMA, EggNOG
Cow535455TEX264testis expressed 2649913VGNC:35765Inparanoid, OMA, EggNOG
Pig102161929TEX264testis expressed 2649823OMA, EggNOG
Opossum100021192TEX264testis expressed 26413616Inparanoid, OMA, EggNOG
Platypus100073531TEX264testis expressed 2649258Inparanoid, OMA, EggNOG
Chicken415938TEX264testis expressed 2649031CGNC:2804Inparanoid, OMA, EggNOG
XenopusTEX264testis expressed 264 [Source:HGNC Symbol;Acc:HGNC:30247]8364OMA, EggNOG
Zebrafish402960tex264atestis expressed 264a7955ZDB-GENE-040426-1885OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.