224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino
| Descrizione | Tumor necrosis factor receptor superfamily member 8 |
|---|
Gene and Protein Information
| Gene ID | 943 |
|---|---|
| Uniprot Accession IDs | P28908 B1AN79 B9EGD9 D3YTD8 Q6P4D9 |
| Ensembl ID | ENSP00000263932 |
| Symbol | CD30 D1S166E CD30 Ki-1 D1S166E |
| Sequence | MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK Mostra altro |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nome | Codice fiscale | Other Gene ID | Sorgenti |
|---|---|---|---|---|---|---|
| Chimp | 457960 | TNFRSF8 | TNF receptor superfamily member 8 | 9598 | VGNC:7012 | OMA, EggNOG |
| Macaque | 722773 | TNFRSF8 | TNF receptor superfamily member 8 | 9544 | OMA, EggNOG | |
| Mouse | 21941 | Tnfrsf8 | tumor necrosis factor receptor superfamily, member 8 | 10090 | MGI:99908 | Inparanoid, OMA, EggNOG |
| Rat | 25069 | Tnfrsf8 | TNF receptor superfamily member 8 | 10116 | RGD:3879 | Inparanoid, OMA, EggNOG |
| Dog | 487438 | TNFRSF8 | TNF receptor superfamily member 8 | 9615 | VGNC:47667 | Inparanoid, OMA, EggNOG |
| Horse | 100055885 | TNFRSF8 | TNF receptor superfamily member 8 | 9796 | VGNC:24373 | Inparanoid, OMA, EggNOG |
| Cow | 614780 | TNFRSF8 | TNF receptor superfamily member 8 | 9913 | VGNC:36170 | Inparanoid, OMA, EggNOG |
| Pig | 100737399 | TNFRSF8 | TNF receptor superfamily member 8 | 9823 | OMA, EggNOG |
Associated Recombinant Proteins
| Nome | Specification and purity | Expression system | Protein label | Disponibilità | Vedi dettagli |
|---|
Associated Antibodies
| Nome | Specifications | Species reactivity | Applicazione | Disponibilità | Vedi dettagli |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nome | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.