🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS CoA Structure
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

PTGER2

DescrizioneProstaglandin E2 receptor EP2 subtype

Gene and Protein Information

Gene ID5732
Uniprot Accession IDs P43116 D3DSC0 Q52LG8 PGE receptor EP2 subtype
Ensembl ID ENSP00000245457
Symbol EP2
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGRRSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGSGRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQALRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp467459PTGER2prostaglandin E receptor 29598VGNC:3332OMA, EggNOG
Macaque708024PTGER2prostaglandin E receptor 29544Inparanoid, OMA, EggNOG
Mouse19217Ptger2prostaglandin E receptor 2 (subtype EP2)10090MGI:97794Inparanoid, OMA, EggNOG
Rat81752Ptger2prostaglandin E receptor 210116RGD:620020Inparanoid, OMA, EggNOG
Dog403797PTGER2prostaglandin E receptor 29615VGNC:45143Inparanoid, OMA, EggNOG
Horse100067279PTGER2prostaglandin E receptor 29796VGNC:21987Inparanoid, OMA, EggNOG
Cow282329PTGER2prostaglandin E receptor 29913VGNC:33502Inparanoid, OMA, EggNOG
PigPTGER2prostaglandin E receptor 2 [Source:HGNC Symbol;Acc:HGNC:9594]9823OMA, EggNOG
Opossum100015803PTGER2prostaglandin E receptor 213616Inparanoid, EggNOG
PlatypusPTGER2prostaglandin E receptor 2 [Source:HGNC Symbol;Acc:HGNC:9594]9258OMA, EggNOG
Anole lizardPTGER2prostaglandin E receptor 2 [Source:HGNC Symbol;Acc:HGNC:9594]28377Inparanoid, OMA, EggNOG
Xenopus100493226ptger2prostaglandin E receptor 28364XB-GENE-967341Inparanoid, OMA, EggNOG
Zebrafish570410ptger2bprostaglandin E receptor 2b (subtype EP2)7955ZDB-GENE-040724-267Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Prostaglandin E2 receptor EP2 subtype
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Prostaglandin E2 receptor EP2 subtype

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.