🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

PPP1R1B

DescrizioneProtein phosphatase 1 regulatory subunit 1B

Gene and Protein Information

Gene ID84152
Uniprot Accession IDs Q9UD71 Q547V9 Q547W0 Q9H7G1
Ensembl ID ENSP00000254079
Symbol DARPP32 DARPP32 DARPP-32
FamilyBelongs to the protein phosphatase inhibitor 1 family.
Sequence
MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp744755PPP1R1Bprotein phosphatase 1 regulatory inhibitor subunit 1B9598VGNC:9534OMA, EggNOG
Macaque574203PPP1R1Bprotein phosphatase 1 regulatory inhibitor subunit 1B9544Inparanoid, OMA, EggNOG
Mouse19049Ppp1r1bprotein phosphatase 1, regulatory (inhibitor) subunit 1B10090MGI:94860Inparanoid, OMA, EggNOG
Rat360616Ppp1r1bprotein phosphatase 1, regulatory (inhibitor) subunit 1B10116RGD:621859Inparanoid, OMA, EggNOG
Dog608394PPP1R1Bprotein phosphatase 1 regulatory inhibitor subunit 1B9615VGNC:44887Inparanoid, OMA, EggNOG
Horse100068204PPP1R1Bprotein phosphatase 1 regulatory inhibitor subunit 1B9796VGNC:21763Inparanoid, OMA, EggNOG
Cow282459PPP1R1Bprotein phosphatase 1 regulatory inhibitor subunit 1B9913VGNC:33234Inparanoid, OMA, EggNOG
Pig100736966PPP1R1Bprotein phosphatase 1 regulatory inhibitor subunit 1B9823OMA, EggNOG
Opossum100017341PPP1R1Bprotein phosphatase 1 regulatory inhibitor subunit 1B13616Inparanoid, OMA, EggNOG
Xenopus100124928ppp1r1bprotein phosphatase 1 regulatory inhibitor subunit 1B8364XB-GENE-958546Inparanoid, EggNOG
Zebrafish100884132ppp1r1bprotein phosphatase 1, regulatory (inhibitor) subunit 1B7955ZDB-GENE-120126-1OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    signaling molecule    /    Protein phosphatase 1 regulatory subunit 1B
protein    /    enzyme modulator    /    phosphatase inhibitor    /    Protein phosphatase 1 regulatory subunit 1B
DTO Classes
protein    /    Enzyme modulator    /    Phosphatase modulator    /    Phosphatase inhibitor    /    Protein phosphatase 1 regulatory subunit 1B

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.