Determine the necessary mass, volume, or concentration for preparing a solution.
PACAP 6-38 TFA, CAS No.143748-18-9(free base)
Disponível para encomenda
GRADE & PURITY ≥95%
Alternar navegação 
Pesquisar
340,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque
Why this grade
≥95% for sensitive chromatographic and analytical workflows requiring minimal baseline interference.
Storage & shipping
Store at -20°C,Desiccated Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.
Quality documents
SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.
Literature proof
Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.
Specifications
Product Name
PACAP 6-38 TFA, CAS No.143748-18-9(free base)
Especificações e pureza
≥95%
Mecanismos bioquímicos e fisiológicos
Potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)1antagonist (IC50= 2 nM). Inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki= 1.5 nM). Antitumor activityin vivo.
Sequência
FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK(Modifications: Lys-33 = C-terminal amide)
CAS
143748-18-9(free base)
Tipo de molécula
Peptídeos
Armazenamento e envio
Condições de armazenamento de armazenamento
Store at -20°C,Desiccated
Enviado em
Ice chest + Ice pads
Documentation
📋 Safety Data Sheet (SDS)
Comprehensive hazard, handling, storage, and regulatory compliance document.
Download SDS →✅ Certificate of Analysis (COA)
Lot-specific quality data. Enter your lot number to retrieve the exact COA.
Look up COA →🔬 Specification Sheet
Full quality attributes and acceptance criteria for this grade.
View spec sheet →Advanced Data
Certificados（CoA,COO,BSE/TSE e Mapa de Análise)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Data | Item |
|---|---|---|---|
 A2422434 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422435 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422436 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422437 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422438 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422439 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422440 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422441 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422442 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422443 | Certificate of Analysis | Dec 19, 2023 | P288450 |
Calculadoras de soluções
Revisões
Avaliações dos Clientes
Lembrar-me mais tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.