Recombinant Mouse G-CSF Protein, ＞97%(SDS-PAGE, HPLC)

Cat. No.: rp154012

GRADE & PURITY Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, ≥97%(SDS-PAGE&HPLC)

Accession #

P09920

Protein Tag

No tag

Expression system

E. coli

Endotoxin Concentration

<0.1 EU/μg

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine NFS-60 cells is less than 0.05ng/ml, corresponding to a specific activity of >2.0 ×10⁷ IU/mg.

Visão geral

Granulocyte colony stimulating factor (G-CSF) is a pleiotropic cytokine. It is mainly produced by monocytes and macrophages upon activation by endotoxin, TNF-α and IFN-γ. Besides, many other cell types can secret this protein after activation by LPS, IL-1 or TNF-α. Various carcinoma cell lines and myeloblastic leukemia cells can express G-CSF constitutively. G-CSF is cytokine that acts in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. In addition, it may function in some adhesion or recognition events at the cell surface. Human G-CSF is 73% identical at the amino acid level to murine G-CSF and the two proteins show species cross-reactivity. Recombinant murine G-CSF is an 18.9kDa polypeptide containing 178 amino acid residues.

Purity

>97% SDS-PAGE

Function

Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes.

Specifications

Product Name

Recombinant Mouse G-CSF Protein, ＞97%(SDS-PAGE, HPLC)

Sinónimos

C17orf33 | chromosome 17 open reading frame 33 | colony stimulating factor 3 (granulocyte) | CSF3 | CSF3OS | Filgrastim | GCSF | G-CSF | GCSFlenograstim | granulocyte colony-stimulating factor | Lenograstim | MGC45931 | Pluripoietin | Csfg | MGI-IG

Grau

ActiBioPure™, Azide Free, Bioactive, Carrier Free, High Performance

Especificações e pureza

ActiBioPure™, Bioactive, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE&HPLC)

Pureza

＞97%(SDS-PAGE, HPLC)

Bioatividade

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine NFS-60 cells is less than 0.05ng/ml, corresponding to a specific activity of >2.0 ×10⁷ IU/mg.

Concentração de endotoxina

<0.1 EU/μg

Sistema de expressão

E.coli

Espécies

Mouse

Aminoácidos

31-208 aa

Sequência

VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPK ASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQ MENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA

Etiqueta de proteína

No tag

Número de acesso

P09920

Peso molecular previsto

18.9kDa

SDS-PAGE

20.2 kDa, under reducing conditions; 20.2 kDa, under non-reducing conditions.

Tipo de molécula

Proteína

Armazenamento e envio

Forma

Lyophilized

Reconstituição

1、This vial mustbebriefly centrifuged prior to opening to bring the contents to the bottom。2、Reconstitute in asterile aqueous buffer to anappropriateconcentration。3、Stock solutions should be apportioned into working aliquots and stored at ≤ -20°C. Further dilutions should be made in appropriate buffered solutions。

Condições de armazenamento de armazenamento

Store at -80°C

Enviado em

Dry ice packs + Cold packs

Estabilidade e armazenamento

Shipped at 4°C. Lyophilized from a 0.2μm filtered solution in 10mM Sodium Citrate, pH4.0, 150mM NaCl, 0.01% Tween-20. Store at -80°C. Avoid freeze / thaw cycle.

Imagens

Protein Bioactivity: Recombinant Mouse G-CSF Protein (rp154012)

Recombinant Mouse G-CSF Protein (rp154012) - Protein Bioactivity
Measured in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED₅₀ for this effect is typically less than 0.05 ng/mL.

SDS-PAGE: Recombinant Mouse G-CSF Protein (rp154012)

Recombinant Mouse G-CSF Protein (rp154012) - SDS-PAGE
2.5 μg/lane of Recombinant Mouse G-CSF was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 20.2 kDa.

Perguntas frequentes

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

What does Bioactive mean?

Bioactive indicates that the product has been processed and tested for biological and biochemical applications. Specifications may include endotoxin limits, microbial controls, sterility, low DNase/RNase/protease activity, and verified biological activity where relevant.

How should this product be stored?

Store at ?80 °C. Ultra-low temperature storage is required to maintain the specified shelf life.

How is this product shipped?

This product ships frozen with dry ice and cold packs. Unpack on arrival and transfer it to the storage condition stated above; handle dry ice with insulated gloves in a ventilated area.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.