Streptavidin, CAS No.9013-20-1

CAS: 9013-20-1 Cat. No.: S1522291 Número CE: 618-481-6 PubChem CID: 51062757

GRADE & PURITY BioReagent, ≥98%

Visão geral

Source：E. coli

Molecular weight：13.3kDa for monomer, 53kDa for tetramer

Accession：P22629 Ala37- Ser163 with an N-terminal Met

Protein amino acid sequence：AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS

Purity：≥98% by SDS-PAGE or HPLC

Formulation：Lyophilized in 20 mM potassium phosphate buffer pH 6.5.

Biotin binding activity ＞17U/mg rSA protein(one unit binds 1µg D-biotin)

Endotoxin level：＜0.01EU/ug rSA protein

Advantage：

1)high biotin binding activity

2)no extra amino sequence (tag free)

3)high purity

Product Form: Lyophilized powder, 20 mM potassium phosphate buffer, pH 6.5.

Product Application：

Streptavidin is a biotin-binding protein that was originally isolated from Streptomyces avidinii. Streptavidin is superior to avidin because it has almost no net charge at neutral pH and does not contain carbohydrate and exhibits lower level of non-specific binding. Recombinant streptavidin is a tetrameric protein with a molecular weight of approximately 53kDa, consisting of four subunits of approximately 13kDa. Each subunit contains a single biotin-binding site and has six tyrosine residues. The purified recombinant streptavidin can be applied in detection of biotinylated antibodies and other probes in a variety of standard assay methods, including Western Blotting, ELISA, immunohistochemistry and fluorescence imaging.：

Streptavidin is a biotin-binding protein that was originally isolated from Streptomyces avidinii. Streptavidin is superior to avidin because it has almost no net charge at neutral pH and does not contain carbohydrate and exhibits lower level of non-specific binding. Recombinant streptavidin is a tetrameric protein with a molecular weight of approximately 53kDa, consisting of four subunits of approximately 13kDa. Each subunit contains a single biotin-binding site and has six tyrosine residues. The purified recombinant streptavidin can be applied in detection of biotinylated antibodies and other probes in a variety of standard assay methods, including Western Blotting, ELISA, immunohistochemistry and fluorescence imaging.

Packaging based on protein content

Specifications

Product Name

Streptavidin, CAS No.9013-20-1

Grau

BioReagent

Especificações e pureza

BioReagent,≥98%

Mecanismos bioquímicos e fisiológicos

Streptavidin is a biotin binding protein and has the ability to bind four molecules of biotin. The biotin binding pocket of streptavidin helps to interact with biotin. It can be used to enhance protein binding and multimerization.

Conjugação

Unconjugated

CAS

9013-20-1

Tipo de molécula

Proteína

Armazenamento e envio

Condições de armazenamento de armazenamento

Store at -20°C,Argon charged

Enviado em

Ice chest + Ice pads

Perguntas frequentes

What is the purity of this product?

This product is supplied at ≥98% purity (chemical assay). Lot-specific values are stated on the Certificate of Analysis.

What does BioReagent mean?

BioReagent indicates that the product has been processed and tested for biological and biochemical applications. Specifications may include endotoxin limits, microbial controls, sterility, low DNase/RNase/protease activity, and verified biological activity where relevant.

How should this product be stored?

Store at ?20 °C under argon. It is supplied under an argon blanket; reseal under inert gas after each use.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.

What are the CAS number, molecular formula and molecular weight?

The CAS Number is 9013-20-1.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.