🌎 Enviar para: United States
Menu
Carrinho
Pesquisar
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Estrutura Bulk & Personalizado
Menu
Conta
Configurações
྾
340,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

RBP4

DescriçãoRetinol-binding protein 4

Gene and Protein Information

Gene ID5950
Uniprot Accession IDs P02753 D3DR38 O43478 O43479 Q5VY24 Q8WWA3 Q9P178
Ensembl ID ENSP00000360522
Symbol RDCCAS MCOPCB10
FamilyBelongs to the calycin superfamily. Lipocalin family.
Sequence
MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp450617RBP4retinol binding protein 49598VGNC:5717Inparanoid, OMA, EggNOG
Mouse19662Rbp4retinol binding protein 4, plasma10090MGI:97879Inparanoid, OMA, EggNOG
Rat25703Rbp4retinol binding protein 410116RGD:3546Inparanoid, OMA, EggNOG
Dog477775RBP4retinol binding protein 49615VGNC:45432Inparanoid, OMA, EggNOG
Horse100049790RBP4retinol binding protein 49796VGNC:49533Inparanoid, OMA, EggNOG
Cow281444RBP4retinol binding protein 49913VGNC:33815Inparanoid, OMA, EggNOG
Pig397124RBP4retinol binding protein 49823Inparanoid, OMA, EggNOG
Opossum100023751RBP4retinol binding protein 413616Inparanoid, EggNOG
Chicken396166RBP4Aretinol binding protein 4 A, plasma9031CGNC:49682Inparanoid, OMA, EggNOG
Anole lizard100566565rbp4retinol binding protein 428377Inparanoid, OMA
Xenopus548465rbp4retinol binding protein 48364XB-GENE-5841608Inparanoid, OMA
Zebrafish30077rbp4retinol binding protein 4, plasma7955ZDB-GENE-000210-19Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeEspecificaçõesSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Usamos cookies para garantir o funcionamento adequado do site e, quando permitido, para melhorar a sua experiência. Você pode gerenciar suas preferências a qualquer momento nas Configurações. Saiba mais em nossa Política de Cookies.

      Deseja que lhe enviemos uma mensagem quando tivermos descontos disponíveis?

      Lembrar-me mais tarde

      Obrigado! Por favor, verifique a sua caixa de entrada de e-mail para confirmar.

      Ops! As notificações estão desativadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.