🌎 Enviar para: United States
Alternar navegação
Carrinho
Pesquisar
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Estrutura Bulk & Personalizado
Menu
Conta
Configurações
྾
340,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

MMP13

DescriçãoCollagenase 3

Gene and Protein Information

Gene ID4322
Uniprot Accession IDs P45452 A8K846 B2RCZ3 Q6NWN6
Ensembl ID ENSP00000260302
Symbol CLG3 MDST MANDP1 MMP-13
FamilyBelongs to the peptidase M10A family.
Sequence
MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp451513MMP13matrix metallopeptidase 139598VGNC:1095OMA, EggNOG
Macaque703980MMP13matrix metallopeptidase 139544Inparanoid, OMA, EggNOG
Mouse17386Mmp13matrix metallopeptidase 1310090MGI:1340026Inparanoid, OMA, EggNOG
Rat171052Mmp13matrix metallopeptidase 1310116RGD:620196Inparanoid, OMA, EggNOG
Dog403763MMP13matrix metallopeptidase 139615VGNC:43276Inparanoid, OMA, EggNOG
Horse100009711MMP13matrix metallopeptidase 139796VGNC:49489Inparanoid, OMA, EggNOG
Cow281914MMP13matrix metallopeptidase 139913VGNC:31518Inparanoid, OMA, EggNOG
Pig397346MMP13matrix metallopeptidase 139823OMA, EggNOG
Opossum100012553MMP13matrix metallopeptidase 1313616Inparanoid, OMA, EggNOG
PlatypusMMP13matrix metallopeptidase 13 [Source:HGNC Symbol;Acc:HGNC:7159]9258OMA, EggNOG
Chicken395683MMP13matrix metallopeptidase 139031CGNC:49430Inparanoid, OMA
Anole lizard100552256mmp13matrix metallopeptidase 1328377Inparanoid, OMA
Xenopus100490019mmp13lmatrix metallopeptidase 13 (collagenase 3) like8364XB-GENE-481559Inparanoid, OMA
Zebrafish100006896mmp13bmatrix metallopeptidase 13b7955ZDB-GENE-030131-6152Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Usamos cookies para garantir o funcionamento adequado do site e, quando permitido, para melhorar a sua experiência. Você pode gerenciar suas preferências a qualquer momento nas Configurações. Saiba mais em nossa Política de Cookies.

      Deseja que lhe enviemos uma mensagem quando tivermos descontos disponíveis?

      Lembrar-me mais tarde

      Obrigado! Por favor, verifique a sua caixa de entrada de e-mail para confirmar.

      Ops! As notificações estão desativadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.