🌎 Enviar para: United States
340,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque
| Descrição | C3a anaphylatoxin chemotactic receptor |
|---|
Gene and Protein Information
| Gene ID | 719 |
|---|---|
| Uniprot Accession IDs | Q16581 O43771 Q92868 C3AR |
| Ensembl ID | ENSP00000302079 |
| Symbol | AZ3B C3R1 HNFAG09 AZ3B C3AR HNFAG09 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIWFLHLTLADLLCCLSLPFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAISLDRCLVVFKPIWCQNHRNVGMACSICGCIWVVAFVMCIPVFVYREIFTTDNHNRCGYKFGLSSSLDYPDFYGDPLENRSLENIVQPPGEMNDRLDPSSFQTNDHPWTVPTVFQPQTFQRPSADSLPRGSARLTSQNLYSNVFKPADVVSPKIPSGFPIEDHETSPLDNSDAFLSTHLKLFPSASSNSFYESELPQGFQDYYNLGQFTDDDQVPTPLVAITITRLVVGFLLPSVIMIACYSFIVFRMQRGRFAKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLSLLTDPETPLGKTLMSWDHVCIALASANSCFNPFLYALLGKDFRKKARQSIQGILEAAFSEELTRSTHCPSNNVISERNSTTV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nome | Número de identificação fiscal | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 466942 | C3AR1 | complement C3a receptor 1 | 9598 | VGNC:5313 | OMA, EggNOG |
| Macaque | 716086 | C3AR1 | complement C3a receptor 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12267 | C3ar1 | complement component 3a receptor 1 | 10090 | MGI:1097680 | Inparanoid, OMA, EggNOG |
| Rat | 84007 | C3ar1 | complement C3a receptor 1 | 10116 | RGD:620537 | Inparanoid, OMA, EggNOG |
| Dog | 486704 | C3AR1 | complement C3a receptor 1 | 9615 | VGNC:38592 | Inparanoid, OMA, EggNOG |
| Horse | 100053275 | C3AR1 | complement C3a receptor 1 | 9796 | VGNC:15952 | Inparanoid, OMA, EggNOG |
| Cow | 540702 | C3AR1 | complement C3a receptor 1 | 9913 | VGNC:26639 | Inparanoid, OMA, EggNOG |
| Chicken | 418198 | C3AR1 | complement C3a receptor 1 | 9031 | CGNC:9977 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100559802 | c3ar1 | complement C3a receptor 1 | 28377 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / receptor / G-protein coupled receptor / C3a anaphylatoxin chemotactic receptor
protein / receptor / G-protein coupled receptor / C3a anaphylatoxin chemotactic receptor
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Anaphylatoxin receptor / C3a anaphylatoxin chemotactic receptor
protein / G-protein coupled receptor / Class A rhodopsin like / Anaphylatoxin receptor / C3a anaphylatoxin chemotactic receptor
Associated Recombinant Proteins
| Nome | Specification and purity | Expression system | Protein label | Disponibilidade | Ver Detalhes |
|---|
Associated Antibodies
| Nome | Especificações | Species reactivity | Aplicação | Disponibilidade | Ver Detalhes |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nome | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Lembrar-me mais tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.