🌎 Enviar para: United States
340,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque
| Descrição | Pre-mRNA-splicing factor SPF27 |
|---|
Gene and Protein Information
| Gene ID | 10286 |
|---|---|
| Uniprot Accession IDs | O75934 Q6FGS0 |
| Ensembl ID | ENSP00000358554 |
| Symbol | DAM1 DAM1 SPF27 Snt309 |
| Family | Belongs to the SPF27 family. |
| Sequence | MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nome | Número de identificação fiscal | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 457143 | BCAS2 | BCAS2, pre-mRNA processing factor | 9598 | VGNC:14799 | OMA, EggNOG |
| Mouse | 68183 | Bcas2 | breast carcinoma amplified sequence 2 | 10090 | MGI:1915433 | Inparanoid, OMA, EggNOG |
| Rat | 295334 | Bcas2 | BCAS2, pre-mRNA processing factor | 10116 | RGD:1306485 | Inparanoid, OMA, EggNOG |
| Dog | 475805 | BCAS2 | BCAS2, pre-mRNA processing factor | 9615 | VGNC:38399 | Inparanoid, OMA, EggNOG |
| Horse | 100065284 | BCAS2 | BCAS2, pre-mRNA processing factor | 9796 | VGNC:15783 | Inparanoid, OMA, EggNOG |
| Cow | 507944 | BCAS2 | BCAS2, pre-mRNA processing factor | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100154006 | BCAS2 | BCAS2, pre-mRNA processing factor | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100030739 | BCAS2 | BCAS2, pre-mRNA processing factor | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100074712 | BCAS2 | BCAS2, pre-mRNA processing factor | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 419884 | BCAS2 | breast carcinoma amplified sequence 2 | 9031 | CGNC:1446 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100562552 | bcas2 | BCAS2, pre-mRNA processing factor | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 394520 | bcas2 | breast carcinoma amplified sequence 2 | 8364 | XB-GENE-959514 | Inparanoid, OMA, EggNOG |
| Zebrafish | 493614 | bcas2 | BCAS2, pre-mRNA processing factor | 7955 | ZDB-GENE-030408-5 | Inparanoid, OMA |
| C. elegans | 188435 | bcas-2 | BCAS splicing factor homolog | 6239 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / mRNA splicing factor / Pre-mRNA-splicing factor SPF27
protein / nucleic acid binding / mRNA splicing factor / Pre-mRNA-splicing factor SPF27
DTO Classes
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / Pre-mRNA-splicing factor SPF27
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / Pre-mRNA-splicing factor SPF27
Associated Recombinant Proteins
| Nome | Specification and purity | Expression system | Protein label | Disponibilidade | Ver Detalhes |
|---|
Associated Antibodies
| Nome | Especificações | Species reactivity | Aplicação | Disponibilidade | Ver Detalhes |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nome | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Lembrar-me mais tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.