🌎 Enviar para: United States
Menu
Carrinho
Pesquisar
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Estrutura Bulk & Personalizado
Menu
Conta
Configurações
྾
340,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

TIMP2

DescriçãoMetalloproteinase inhibitor 2

Gene and Protein Information

Gene ID7077
Uniprot Accession IDs P16035 Q16121 Q93006 Q9UDF7
Ensembl ID ENSP00000262768
Symbol DDC8 CSC-21K
FamilyBelongs to the protease inhibitor I35 (TIMP) family.
Sequence
MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp743167TIMP2TIMP metallopeptidase inhibitor 29598VGNC:9705OMA, EggNOG
Mouse21858Timp2tissue inhibitor of metalloproteinase 210090MGI:98753Inparanoid, OMA, EggNOG
Rat29543Timp2TIMP metallopeptidase inhibitor 210116RGD:61312Inparanoid, OMA, EggNOG
Dog403633TIMP2TIMP metallopeptidase inhibitor 29615Inparanoid, EggNOG
Horse100034134TIMP2TIMP metallopeptidase inhibitor 29796OMA, EggNOG
Cow282093TIMP2TIMP metallopeptidase inhibitor 29913VGNC:35871Inparanoid, OMA, EggNOG
Pig396988TIMP2TIMP metallopeptidase inhibitor 29823OMA, EggNOG
Opossum100030996TIMP2TIMP metallopeptidase inhibitor 213616Inparanoid, OMA, EggNOG
Chicken374178TIMP2TIMP metallopeptidase inhibitor 29031CGNC:49073Inparanoid, OMA
Anole lizard100566015timp2TIMP metallopeptidase inhibitor 228377Inparanoid, OMA, EggNOG
Xenopus548477timp2TIMP metallopeptidase inhibitor 28364XB-GENE-949671Inparanoid, OMA, EggNOG
Zebrafish359835timp2aTIMP metallopeptidase inhibitor 2a7955ZDB-GENE-030612-1Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeEspecificaçõesSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Usamos cookies para garantir o funcionamento adequado do site e, quando permitido, para melhorar a sua experiência. Você pode gerenciar suas preferências a qualquer momento nas Configurações. Saiba mais em nossa Política de Cookies.

      Deseja que lhe enviemos uma mensagem quando tivermos descontos disponíveis?

      Lembrar-me mais tarde

      Obrigado! Por favor, verifique a sua caixa de entrada de e-mail para confirmar.

      Ops! As notificações estão desativadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.