GNLY

DescriçãoGranulysin

Gene and Protein Information

Gene ID10578
Uniprot Accession IDs P22749 P09325 Q6GU08
Ensembl ID ENSP00000263863
Symbol LAG2 NKG5 TLA519 LAG2 NKG5 LAG-2 D2S69E TLA519
Sequence
MATWALLLLAAMLLGNPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp459370GNLYgranulysin9598VGNC:267OMA, EggNOG
Horse100034133GNLYgranulysin9796VGNC:49458OMA, EggNOG
Cow616323LOC616323uncharacterized LOC6163239913OMA, EggNOG
Pig396869GNLYgranulysin9823OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.