🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS CoA Structure
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

KLRK1

DescriçãoNKG2-D type II integral membrane protein

Gene and Protein Information

Gene ID100528032
Uniprot Accession IDs P26718 A8K7K5 A8K7P4 Q9NR41
Ensembl ID ENSP00000240618
Symbol D12S2489E NKG2D
Sequence
MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp450153KLRK1killer cell lectin like receptor K19598VGNC:52050Inparanoid, OMA, EggNOG
Macaque574240NKG2DNKG2D protein9544Inparanoid, OMA
Mouse27007Klrk1killer cell lectin-like receptor subfamily K, member 110090MGI:1196250Inparanoid, OMA, EggNOG
Rat24934Klrk1killer cell lectin like receptor K110116RGD:3180Inparanoid, OMA
Dog611355KLRK1killer cell lectin like receptor K19615Inparanoid, OMA, EggNOG
Horse100053963KLRK1killer cell lectin like receptor K19796VGNC:52401Inparanoid, OMA, EggNOG
Cow404058KLRK1killer cell lectin-like receptor subfamily K, member 19913Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.