O JavaScript parece estar desativado no seu browser. Para usufruir da melhor experiência no nosso site, certifique-se que ativa o JavaScript no seu browser.

Idioma

Moeda

Início
Targets(Human)
RAP2C

RAP2C

Descrição	Ras-related protein Rap-2c

Gene and Protein Information

Gene ID	57826
Uniprot Accession IDs	Q9Y3L5 B3KWD6 Q5H9H9 Q9BTS0
Ensembl ID	ENSP00000340274
Family	Belongs to the small GTPase superfamily. Ras family.
Sequence	MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGCPFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTTCVVQ

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Nome	Número de identificação fiscal	Other Gene ID	Sources
Mouse	72065	Rap2c	RAP2C, member of RAS oncogene family	10090	MGI:1919315	Inparanoid, OMA
Rat	302495	Rap2c	RAP2C, member of RAS oncogene family	10116	RGD:1588562	Inparanoid, OMA
Dog	481054	RAP2C	RAP2C, member of RAS oncogene family	9615	VGNC:45345	Inparanoid, OMA
Horse	100054364	RAP2C	RAP2C, member of RAS oncogene family	9796	VGNC:22178	Inparanoid, OMA
Cow	515181	RAP2C	RAP2C, member of RAS oncogene family	9913	VGNC:33721	Inparanoid, OMA
Opossum	100022678	RAP2C	RAP2C, member of RAS oncogene family	13616		Inparanoid, OMA
Platypus	100084311	RAP2C	RAP2C, member of RAS oncogene family	9258		Inparanoid, OMA
Chicken	422232	RAP2C	RAP2C, member of RAS oncogene family	9031	CGNC:51667	Inparanoid, OMA
Xenopus	549652	rap2c	RAP2C, member of RAS oncogene family	8364	XB-GENE-489027	Inparanoid, OMA
Zebrafish	474323	rap2c	RAP2C, member of RAS oncogene family	7955	ZDB-GENE-041024-1	Inparanoid, OMA

Protein Classes

PANTHER Classes
protein / enzyme modulator / small GTPase / Ras-related protein Rap-2c

DTO Classes
protein / Enzyme modulator / G-protein / Small GTPase / Ras-related protein Rap-2c

Associated Recombinant Proteins

Nome	Specification and purity	Expression system	Protein label	Disponibilidade	Ver Detalhes

Associated Antibodies

Nome	Specifications	Species reactivity	Aplicação	Disponibilidade	Ver Detalhes

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Nome	Direct Associated Targets	Disease Type	Mondoid

Bibliography

🔙[Back to Target (Human)]

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.