🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

GRK1

DescriçãoRhodopsin kinase

Gene and Protein Information

Gene ID6011
Uniprot Accession IDs Q15835 Q53X14 RK
Ensembl ID ENSP00000334876
Symbol RHOK RK RHOK GPRK1
FamilyBelongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. GPRK subfamily.
Sequence
MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFESVCLEQPIGKKLFQQFLQSAEKHLPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAKLFCSFLDEGIVAKFKEGPVEIQDGLFQPLLQATLAHLGQAPFQEYLGSLYFLRFLQWKWLEAQPMGEDWFLDFRVLGKGGFGEVSACQMKATGKLYACKKLNKKRLKKRKGYQGAMVEKKILMKVHSRFIVSLAYAFETKADLCLVMTIMNGGDIRYHIYNVNEENPGFPEPRALFYTAQIICGLEHLHQRRIVYRDLKPENVLLDNDGNVRISDLGLAVELLDGQSKTKGYAGTPGFMAPELLQGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLRAHPLFKDLNWRQLEAGMLMPPFIPDSKTVYAKDIQDVGAFSTVKGVAFDKTDTEFFQEFATGNCPIPWQEEMIETGIFGELNVWRSDGQMPDDMKGISGGSSSSSKSGMCLVS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp467338GRK1G protein-coupled receptor kinase 19598VGNC:13112Inparanoid, OMA, EggNOG
Macaque715484GRK1G protein-coupled receptor kinase 19544OMA, EggNOG
Mouse24013Grk1G protein-coupled receptor kinase 110090MGI:1345146Inparanoid, OMA, EggNOG
Rat81760Grk1G protein-coupled receptor kinase 110116RGD:619712Inparanoid, OMA, EggNOG
Dog485557GRK1G protein-coupled receptor kinase 19615VGNC:41501Inparanoid, OMA, EggNOG
Horse100069151GRK1G protein-coupled receptor kinase 19796VGNC:18593Inparanoid, OMA, EggNOG
Cow281457GRK1G protein-coupled receptor kinase 19913VGNC:29654Inparanoid, OMA, EggNOG
Pig100620646GRK1G protein-coupled receptor kinase 19823OMA, EggNOG
Opossum100016174GRK1G protein-coupled receptor kinase 113616Inparanoid, OMA, EggNOG
Platypus100078720GRK1G protein-coupled receptor kinase 19258Inparanoid, OMA, EggNOG
Anole lizard100562054grk1G protein-coupled receptor kinase 128377Inparanoid, EggNOG
Xenopus100486335grk1G protein-coupled receptor kinase 18364XB-GENE-1012638Inparanoid, OMA, EggNOG
Zebrafish564152grk1aG protein-coupled receptor kinase 1 a7955ZDB-GENE-050823-1Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.