🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

KCNK17

DescriçãoPotassium channel subfamily K member 17

Gene and Protein Information

Gene ID89822
Uniprot Accession IDs Q96T54 E9PB46 Q5TCF4 Q8TAW4 Q9BXD1 Q9H592
Ensembl ID ENSP00000362328
Symbol TALK2 TASK4 TALK2 TASK4 TALK-2 TASK-4 K2p17.1
FamilyBelongs to the two pore domain potassium channel (TC 1.A.1.8) family.
Sequence
MYRPRARAAPEGRVRGCAVPSTVLLLLAYLAYLALGTGVFWTLEGRAAQDSSRSFQRDKWELLQNFTCLDRPALDSLIRDVVQAYKNGASLLSNTTSMGRWELVGSFFFSVSTITTIGYGNLSPNTMAARLFCIFFALVGIPLNLVVLNRLGHLMQQGVNHWASRLGGTWQDPDKARWLAGSGALLSGLLLFLLLPPLLFSHMEGWSYTEGFYFAFITLSTVGFGDYVIGMNPSQRYPLWYKNMVSLWILFGMAWLALIIKLILSQLETPGRVCSCCHHSSKEDFKSQSWRQGPDREPESHSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp748287KCNK17potassium two pore domain channel subfamily K member 179598VGNC:7898OMA, EggNOG
Macaque719574KCNK17potassium two pore domain channel subfamily K member 179544OMA, EggNOG
Dog481781KCNK16potassium two pore domain channel subfamily K member 169615OMA, EggNOG
Horse100065439KCNK17potassium two pore domain channel subfamily K member 179796VGNC:19295Inparanoid, OMA, EggNOG
Cow282264KCNK17potassium two pore domain channel subfamily K member 179913VGNC:30470Inparanoid, OMA, EggNOG
Pig106507367KCNK17potassium two pore domain channel subfamily K member 179823OMA, EggNOG
Chicken421423KCNK17potassium two pore domain channel subfamily K member 179031CGNC:7653Inparanoid, OMA, EggNOG
Anole lizard100564501kcnk17potassium two pore domain channel subfamily K member 1728377Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Ion channel    /    Two pore domain potassium channel family    /    Potassium channel subfamily K member 17

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.