🌎 Enviar para: United States
340,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque
| Descrição | Heme oxygenase 1 |
|---|
Gene and Protein Information
| Gene ID | 3162 |
|---|---|
| Uniprot Accession IDs | P09601 HO-1 |
| Ensembl ID | ENSP00000216117 |
| Symbol | HO HO1 HO-1 HSP32 HMOX1D bK286B10 |
| Family | Belongs to the heme oxygenase family. |
| Sequence | MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nome | Número de identificação fiscal | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 470195 | HMOX1 | heme oxygenase 1 | 9598 | VGNC:5270 | OMA, EggNOG |
| Macaque | 719266 | HMOX1 | heme oxygenase 1 | 9544 | Inparanoid, OMA | |
| Mouse | 15368 | Hmox1 | heme oxygenase 1 | 10090 | MGI:96163 | Inparanoid, OMA, EggNOG |
| Rat | 24451 | Hmox1 | heme oxygenase 1 | 10116 | RGD:2806 | Inparanoid, OMA, EggNOG |
| Dog | 442987 | HMOX1 | heme oxygenase 1 | 9615 | VGNC:41719 | Inparanoid, OMA, EggNOG |
| Horse | 100069058 | HMOX1 | heme oxygenase 1 | 9796 | VGNC:18814 | Inparanoid, OMA, EggNOG |
| Cow | 513221 | HMOX1 | heme oxygenase 1 | 9913 | VGNC:29885 | Inparanoid, OMA, EggNOG |
| Opossum | 100030714 | LOC100030714 | heme oxygenase 1-like | 13616 | OMA, EggNOG | |
| Platypus | HMOX1 | heme oxygenase 1 [Source:HGNC Symbol;Acc:HGNC:5013] | 9258 | OMA, EggNOG | ||
| Chicken | 396287 | HMOX1 | heme oxygenase 1 | 9031 | CGNC:49737 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100555210 | hmox1 | heme oxygenase 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100488303 | hmox1 | heme oxygenase 1 | 8364 | XB-GENE-1002243 | Inparanoid, OMA, EggNOG |
| Zebrafish | 791518 | hmox1a | heme oxygenase 1a | 7955 | ZDB-GENE-030131-3102 | OMA, EggNOG |
Associated Recombinant Proteins
| Nome | Specification and purity | Expression system | Protein label | Disponibilidade | Ver Detalhes |
|---|
Associated Antibodies
| Nome | Especificações | Species reactivity | Aplicação | Disponibilidade | Ver Detalhes |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nome | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Lembrar-me mais tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.