🌎 Enviar para: United States
Menu
Carrinho
Pesquisar
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Estrutura Bulk & Personalizado
Menu
Conta
Configurações
྾
340,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

IL10RB

DescriçãoInterleukin-10 receptor subunit beta

Gene and Protein Information

Gene ID3588
Uniprot Accession IDs Q08334 Q9BUU4 IL-10 receptor subunit beta
Ensembl ID ENSP00000290200
Symbol CRFB4 D21S58 D21S66 CRFB4 CRF2-4 D21S58 D21S66 CDW210B IL-10R2
FamilyBelongs to the type II cytokine receptor family.
Sequence
MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAEDSESGKQNPGDSCSLGTPPGQGPQS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp473966LOC473966interleukin-10 receptor subunit beta9598OMA, EggNOG
Mouse16155Il10rbinterleukin 10 receptor, beta10090MGI:109380Inparanoid, OMA, EggNOG
Rat304091Il10rbinterleukin 10 receptor subunit beta10116RGD:1560373Inparanoid, OMA, EggNOG
Dog100856489IL10RBinterleukin 10 receptor subunit beta9615Inparanoid, EggNOG
Horse100052549IL10RBinterleukin 10 receptor subunit beta9796OMA, EggNOG
Cow767864IL10RBinterleukin 10 receptor subunit beta9913Inparanoid, OMA, EggNOG
Opossum100026691IL10RBinterleukin 10 receptor subunit beta13616OMA, EggNOG
Anole lizard103281134LOC103281134interleukin-10 receptor subunit beta28377OMA, EggNOG
Zebrafish797527crfb4cytokine receptor family member b47955ZDB-GENE-070905-3OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    type II cytokine receptor    /    Interleukin-10 receptor subunit beta
protein    /    receptor    /    defense/immunity protein    /    Interleukin-10 receptor subunit beta
protein    /    receptor    /    type I cytokine receptor    /    Interleukin-10 receptor subunit beta
DTO Classes
protein    /    Receptor    /    Cytokine receptor    /    Type II cytokine receptor    /    Interleukin-10 receptor subunit beta

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeEspecificaçõesSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Usamos cookies para garantir o funcionamento adequado do site e, quando permitido, para melhorar a sua experiência. Você pode gerenciar suas preferências a qualquer momento nas Configurações. Saiba mais em nossa Política de Cookies.

      Deseja que lhe enviemos uma mensagem quando tivermos descontos disponíveis?

      Lembrar-me mais tarde

      Obrigado! Por favor, verifique a sua caixa de entrada de e-mail para confirmar.

      Ops! As notificações estão desativadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.