🌎 Enviar para: United States
Menu
Carrinho
Pesquisar
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Estrutura Bulk & Personalizado
Menu
Conta
Configurações
྾
340,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

TMPRSS2

DescriçãoTransmembrane protease serine 2

Gene and Protein Information

Gene ID7113
Uniprot Accession IDs O15393 A8K6Z8 B2R8E5 B7Z459 D3DSJ2 F8WES1 Q6GTK7 Q9BXX1
Ensembl ID ENSP00000381588
Symbol PRSS10 PP9284 PRSS10
FamilyBelongs to the peptidase S1 family.
Sequence
MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp474007TMPRSS2transmembrane serine protease 29598VGNC:3729OMA, EggNOG
Macaque715138TMPRSS2transmembrane protease, serine 29544OMA, EggNOG
Mouse50528Tmprss2transmembrane protease, serine 210090MGI:1354381Inparanoid, OMA, EggNOG
Rat156435Tmprss2transmembrane serine protease 210116RGD:620766Inparanoid, OMA, EggNOG
Dog487770TMPRSS2transmembrane serine protease 29615VGNC:53045Inparanoid, OMA, EggNOG
Horse100058498TMPRSS2transmembrane serine protease 29796VGNC:24341Inparanoid, OMA, EggNOG
Cow511037TMPRSS2transmembrane serine protease 29913VGNC:36140Inparanoid, OMA, EggNOG
Opossum100016391TMPRSS2transmembrane protease, serine 213616Inparanoid, OMA, EggNOG
Chicken418528TMPRSS2transmembrane protease, serine 29031CGNC:12069Inparanoid, OMA
Anole lizard100552320tmprss2transmembrane protease, serine 228377Inparanoid, OMA
Zebrafish494080tmprss2transmembrane serine protease 27955ZDB-GENE-041212-48Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeEspecificaçõesSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Usamos cookies para garantir o funcionamento adequado do site e, quando permitido, para melhorar a sua experiência. Você pode gerenciar suas preferências a qualquer momento nas Configurações. Saiba mais em nossa Política de Cookies.

      Deseja que lhe enviemos uma mensagem quando tivermos descontos disponíveis?

      Lembrar-me mais tarde

      Obrigado! Por favor, verifique a sua caixa de entrada de e-mail para confirmar.

      Ops! As notificações estão desativadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.