🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

TNFSF4

DescriçãoTumor necrosis factor ligand superfamily member 4

Gene and Protein Information

Gene ID7292
Uniprot Accession IDs P23510 Q5JZA5 Q8IV74 Q9HCN9
Ensembl ID ENSP00000281834
Symbol TXGP1 GP34 CD252 OX4OL TXGP1 CD134L OX-40L TNLG2B
FamilyBelongs to the tumor necrosis factor family.
Sequence
MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp469586TNFSF4TNF superfamily member 49598VGNC:7014OMA, EggNOG
Macaque706255TNFSF4TNF superfamily member 49544Inparanoid, OMA, EggNOG
Mouse22164Tnfsf4tumor necrosis factor (ligand) superfamily, member 410090MGI:104511Inparanoid, OMA, EggNOG
Rat89814Tnfsf4TNF superfamily member 410116RGD:619816Inparanoid, OMA, EggNOG
Dog100855878TNFSF4TNF superfamily member 49615VGNC:47672Inparanoid, OMA, EggNOG
Horse100060605TNFSF4TNF superfamily member 49796VGNC:24379Inparanoid, OMA, EggNOG
Cow539800TNFSF4TNF superfamily member 49913VGNC:36176Inparanoid, OMA, EggNOG
Pig574053TNFSF4TNF superfamily member 49823Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    tumor necrosis factor family member    /    Tumor necrosis factor ligand superfamily member 4
DTO Classes
protein    /    Signaling    /    Cytokine    /    Tumor necrosis factor family member    /    Tumor necrosis factor ligand superfamily member 4

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.