🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS CoA Structure
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

GPR35

DescriçãoG-protein coupled receptor 35

Gene and Protein Information

Gene ID2859
Uniprot Accession IDs Q9HC97 J3KR30 O43495 Q17R58 Q4VBN5 Q4ZFV2 Q6FHI8 Q86UH4
Ensembl ID ENSP00000411788
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMTNLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRHPLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVRLAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKSQDSLCVTLA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp460070GPR35G protein-coupled receptor 359598VGNC:1951OMA, EggNOG
Macaque699073GPR35G protein-coupled receptor 359544Inparanoid, OMA, EggNOG
Mouse64095Gpr35G protein-coupled receptor 3510090MGI:1929509Inparanoid, OMA, EggNOG
Rat367315Gpr35G protein-coupled receptor 3510116RGD:1309404Inparanoid, OMA, EggNOG
Dog100855802LOC100855802G-protein coupled receptor 35-like9615OMA, EggNOG
HorseGPR35G protein-coupled receptor 35 [Source:HGNC Symbol;Acc:HGNC:4492]9796OMA, EggNOG
Cow505056GPR35G protein-coupled receptor 359913VGNC:29584Inparanoid, OMA, EggNOG
Opossum100021803LOC100021803G-protein coupled receptor 35-like13616OMA, EggNOG
Platypus100080746GPR35G protein-coupled receptor 359258OMA, EggNOG
Anole lizard100557680gpr35G protein-coupled receptor 3528377Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    G-protein coupled receptor 35

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.