🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS CoA Structure
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

SHBG

DescriçãoSex hormone-binding globulin

Gene and Protein Information

Gene ID6462
Uniprot Accession IDs P04278 B0FWH4 E9PGW1 F5H5Z8 I3L1N7 P14689 Q16616 Q3MIL0 Q6ISD2 SHBG
Ensembl ID ENSP00000369816
Symbol ABP SBP TEBG
Sequence
MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp455215SHBGsex hormone binding globulin9598VGNC:9607OMA, EggNOG
Macaque716004SHBGsex hormone binding globulin9544Inparanoid, OMA, EggNOG
Mouse20415Shbgsex hormone binding globulin10090MGI:98295Inparanoid, OMA, EggNOG
Rat24775Shbgsex hormone binding globulin10116RGD:3671Inparanoid, OMA, EggNOG
Dog100856157SHBGsex hormone binding globulin9615VGNC:46139Inparanoid, OMA, EggNOG
Horse100073011SHBGsex hormone binding globulin9796VGNC:22954Inparanoid, OMA, EggNOG
Cow404182SHBGsex hormone binding globulin9913VGNC:34589Inparanoid, OMA, EggNOG
Opossum100015497SHBGsex hormone binding globulin13616Inparanoid, OMA, EggNOG
Zebrafish322604shbgsex hormone-binding globulin7955ZDB-GENE-030131-1324Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.