🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

PHYHD1

DescriçãoPhytanoyl-CoA dioxygenase domain-containing protein 1

Gene and Protein Information

Gene ID254295
Uniprot Accession IDs Q5SRE7 A6PWN9 A6PWP0 B3KT57 B4E3X8 Q5SRE9 Q5SRF0 Q7Z623 Q7Z7P9 Q96GM4
Ensembl ID ENSP00000309515
FamilyBelongs to the PhyH family. PHYHD1 subfamily.
Sequence
MACLSPSQLQKFQQDGFLVLEGFLSAEECVAMQQRIGEIVAEMDVPLHCRTEFSTQEEEQLRAQGSTDYFLSSGDKIRFFFEKGVFDEKGNFLVPPEKSINKIGHALHAHDPVFKSITHSFKVQTLARSLGLQMPVVVQSMYIFKQPHFGGEVSPHQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSGVSRRMVRAPVGSAPGTSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTWSPENWLQPTAELPFPQLYT
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp464911PHYHD1phytanoyl-CoA dioxygenase domain containing 19598VGNC:4820OMA, EggNOG
Macaque717104PHYHD1phytanoyl-CoA dioxygenase domain containing 19544Inparanoid, OMA, EggNOG
Mouse227696Phyhd1phytanoyl-CoA dioxygenase domain containing 110090MGI:3612860Inparanoid, EggNOG
Rat296621Phyhd1phytanoyl-CoA dioxygenase domain containing 110116RGD:1310377Inparanoid, EggNOG
Dog608889PHYHD1phytanoyl-CoA dioxygenase domain containing 19615Inparanoid, EggNOG
Cow540828PHYHD1phytanoyl-CoA dioxygenase domain containing 19913Inparanoid, EggNOG
Pig110255203PHYHD1phytanoyl-CoA dioxygenase domain containing 19823Inparanoid, EggNOG
Opossum100013766PHYHD1phytanoyl-CoA dioxygenase domain containing 113616Inparanoid, EggNOG
Xenopus100135401phyhd1phytanoyl-CoA dioxygenase domain containing 18364XB-GENE-966497Inparanoid, EggNOG
Zebrafish492804phyhd1phytanoyl-CoA dioxygenase domain containing 17955ZDB-GENE-041114-159Inparanoid, EggNOG
C. elegans178445Y105C5B.9Phytanoyl-CoA dioxygenase domain-containing protein 1 homolog6239Inparanoid, EggNOG
Fruitfly41275CG14688CG14688 gene product from transcript CG14688-RB7227FBgn0037819Inparanoid, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.