PNPLA8

DescriçãoCalcium-independent phospholipase A2-gamma

Gene and Protein Information

Gene ID50640
Uniprot Accession IDs Q9NP80 A4D0S1 C9JZI4 O95035 Q8N3I3 Q9H7T5 Q9NR17 Q9NUN2 Q9NZ79
Ensembl ID ENSP00000410804
Symbol IPLA22 IPLA2G MMLA IPLA2G IPLA2-2 iPLA2gamma PNPLA-gamma
Sequence
MSINLTVDIYIYLLSNARSVCGKQRSKQLYFLFSPKHYWRISHISLQRGFHTNIIRCKWTKSEAHSCSKHCYSPSNHGLHIGILKLSTSAPKGLTKVNICMSRIKSTLNSVSKAVFGNQNEMISRLAQFKPSSQILRKVSDSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENEHFRDKSELEDKKVEEGKLRSPDPGILAYKPGSESVHTVDKPTSPSAIPDVLQVSTKQSIANFLSRPTEGVQALVGGYIGGLVPKLKYDSKSQSEEQEEPAKTDQAVSKDRNAEEKKRLSLQREKIIARVSIDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPYLLRLRQIKDETLQAAVREILALIGYVDPVKGRGIRILSIDGGGTRGVVALQTLRKLVELTQKPVHQLFDYICGVSTGAILAFMLGLFHMPLDECEELYRKLGSDVFSQNVIVGTVKMSWSHAFYDSQTWENILKDRMGSALMIETARNPTCPKVAAVSTIVNRGITPKAFVFRNYGHFPGINSHYLGGCQYKMWQAIRASSAAPGYFAEYALGNDLHQDGGLLLNNPSALAMHECKCLWPDVPLECIVSLGTGRYESDVRNTVTYTSLKTKLSNVINSATDTEEVHIMLDGLLPPDTYFRFNPVMCENIPLDESRNEKLDQLQLEGLKYIERNEQKMKKVAKILSQEKTTLQKINDWIKLKTDMYEGLPFFSKL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp472484PNPLA8patatin like phospholipase domain containing 89598VGNC:4472OMA, EggNOG
Macaque700851PNPLA8patatin like phospholipase domain containing 89544Inparanoid, OMA
Mouse67452Pnpla8patatin-like phospholipase domain containing 810090MGI:1914702Inparanoid, OMA, EggNOG
Rat314075Pnpla8patatin-like phospholipase domain containing 810116RGD:1311444Inparanoid, OMA, EggNOG
Dog475880PNPLA8patatin like phospholipase domain containing 89615VGNC:44758Inparanoid, OMA, EggNOG
Horse100060568PNPLA8patatin like phospholipase domain containing 89796VGNC:21638Inparanoid, OMA, EggNOG
Cow535496PNPLA8patatin like phospholipase domain containing 89913VGNC:33095Inparanoid, OMA, EggNOG
Opossum100010579PNPLA8patatin like phospholipase domain containing 813616Inparanoid, OMA, EggNOG
Chicken417785PNPLA8patatin like phospholipase domain containing 89031CGNC:7233OMA, EggNOG
Anole lizard100558210pnpla8patatin like phospholipase domain containing 828377Inparanoid, OMA, EggNOG
Xenopus100038186pnpla8patatin like phospholipase domain containing 88364XB-GENE-495321Inparanoid, OMA, EggNOG
Zebrafish100126812pnpla8patatin-like phospholipase domain containing 87955ZDB-GENE-070705-553Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.