Recombinant Human Apolipoprotein E3 Protein, >95%(SDS-PAGE)

Cat. No.: rp142912
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Accession #
P02649
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Human ApoE at 5μg/mL (100 μL/well) can bind Human TREM2 with a linear range of 0.6-65 ng/mL .
★
Size
Alemania (EU)
USA*
Price
Qty
10μg
rp142912-10μg
—
3 Disponible
51,98€
50μg
rp142912-50μg
—
3 Disponible
121,40€
500μg
rp142912-500μg
Fabricado bajo pedido · 8–12 semanas
25,95€
100μg
rp142912-100μg
—
2 Disponible
194,29€
1mg
rp142912-1mg
Fabricado bajo pedido · 8–12 semanas
983,93€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His-Tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human Apolipoprotein E3 Protein, >95%(SDS-PAGE)
Sinónimos
Apo-E | AD2 | Apo-E | ApoE4 | apolipoprotein E | Apolipoprotein E3 | LDLCQ5 | LPG
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag
Especificaciones y pureza
Animal Free,Carrier Free,Bioactive,ActiBioPure™,His-Tag,≥95%(SDS-PAGE)
Mecanismos bioquímicos y fisiológicos
ApoE, a glycoprotein, is a structural component of very low density lipoprotein (vLDL) synthesized by the liver and intestinally synthesized chylomicrons . ApoE is also a constituent of a subclass of high density of lipoproteins (HDL) involved in choleste
Pureza
>95%(SDS-PAGE)
Bioactividad
Immobilized Human ApoE at 5μg/mL (100 μL/well) can bind Human TREM2 with a linear range of 0.6-65 ng/mL .
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
HEK293
Especie
Human
Aminoácidos
19-317 aa
Secuencia
KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNHHHHHHH
Etiqueta proteínica
His
Número de adhesión
Peso molecular previsto
35.1 kDa
SDS-PAGE
36-38 kDa, under reducing conditions
Tipo de molécula
Proteína
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human Apolipoprotein E3 Protein (rp142912) - SDS-PAGE
2 μg/lane of Recombinant Human Apolipoprotein E3 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 30 - 36 kDa under reducing conditions and 30 - 36 & 80 kDa under non-reducing conditions.
APOE exists as multiple glycosylated and sialylated glycoforms within cells and in plasma (PubMed:29516132). The protein has a calculated MW of 35 kDa. The protein migrates as 30 - 36 kDa under reducing (R) condition due to glycosylation.


Recombinant Human Apolipoprotein E3 Protein (rp142912) - Binding Activity
Immobilized Recombinant Human Apolipoprotein E3 Protein (rp142912) at 5 μg/mL can bind Recombinant Human TREM2 Protein with the EC₅₀ of 71.16 ng/mL.


Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ25F0825636Certificate of AnalysisJun 22, 2026 rp142912
ZJ25F0825637Certificate of AnalysisJun 22, 2026 rp142912
ZJ25F0825638Certificate of AnalysisJun 22, 2026 rp142912
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Preguntas frecuentes

What is the purity of this product, and how is it determined?
This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.
What does Animal Free mean?
Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
What does Carrier Free mean?
Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
How should this product be stored?
Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.
How is this product shipped?
This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.