Recombinant Human CD33 Protein, >95%(SDS-PAGE)

Cat. No.: rp143966
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. Fc tag ? Fc tag grade — recombinant protein bearing a Fc tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. The Fc tag aids dimerization and protein-A/G capture. ≥95%(SDS-PAGE)
Accession #
P20138
Protein Tag
C-hFc & His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
1、Measured by the ability of the immobilized protein to support the adhesion of human red blood cells. The ED50 for this effect is 1‑4 µg/mL. 2、Immobilized Recombinant Human CD33 Protein (rp143966) at 2.0 μg/mL can bind Gemtuzumab (anti-CD33) (Ab175859). The ED50 for this effect is 391.3 ng/mL.
Size
Alemania (EU)
USA*
Price
Qty
10μg
rp143966-10μg
Disponible ≥10
104,04€
50μg
rp143966-50μg
8 Disponible
294,94€
100μg
rp143966-100μg
3 Disponible
451,14€
1mg
rp143966-1mg
Fabricado bajo pedido · 8–12 semanas
3.297,32€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His-Tag,Fc tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,Fc tag,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity

>95% SDS-PAGE


Additional sequence information

Fc, 6His tag at the C-terminus.


Function

Putative adhesion molecule of myelomonocytic-derived cells that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. Induces apoptosis in acute myeloid leukemia (in vitro).


Post-translational

Phosphorylation of Tyr-340 is involved in binding to PTPN6 and PTPN11. Phosphorylation of Tyr-358 is involved in binding to PTPN6.

Specifications

Product Name
Recombinant Human CD33 Protein, >95%(SDS-PAGE)
Sinónimos
CD33 antigen (gp67) | CD33 antigen | CD33 molecule | CD33 | FLJ00391 | gp67 | myeloid cell surface antigen CD33 | p67 | sialic acid binding Ig-like lectin 3 | Sialic acid-binding Ig-like lectin 3 | Siglec3 | Siglec-3 | SIGLEC3gp67
Grado
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, Fc tag, High Performance, His Tag
Especificaciones y pureza
Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His-Tag,Fc tag,≥95%(SDS-PAGE)
Pureza
>95%(SDS-PAGE)
Bioactividad
1、Measured by the ability of the immobilized protein to support the adhesion of human red blood cells. The ED50 for this effect is 1‑4 µg/mL. 2、Immobilized Recombinant Human CD33 Protein (rp143966) at 2.0 μg/mL can bind Gemtuzumab (anti-CD33) (Ab175859). The ED50 for this effect is 391.3 ng/mL.
Concentración de endotoxinas
<0.1 EU/μg
Sistema de expresión
HEK293
Especie
Human
Aminoácidos
18-267 aa
Secuencia
DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHENLYFQGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Etiqueta proteínica
C-Fc & His
Número de adhesión
Peso molecular previsto
54 kDa
SDS-PAGE
71.0 kDa, under reducing conditions ; 150.7 kDa, under non-reducing conditions.
Tipo de molécula
Proteína
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
Reconstitute in water to a concentration of 0.1-0.5 mg/ml.
Condiciones de almacenamiento de almacenamiento
Store at -20°C
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20~-80℃ for more than 1 year
Imágenes

Recombinant Human CD33 Protein (rp143966) - Protein Bioactivity
Immobilized Recombinant Human CD33 Protein (rp143966) at 2.0 μg/mL can bind CD33 Mouse mAb (Ab006571). The ED₅₀ for this effect is 251.9 ng/mL.

Recombinant Human CD33 Protein (rp143966) - Protein Bioactivity
Immobilized Recombinant Human CD33 Protein (rp143966) at 2.0 μg/mL can bind Gemtuzumab (anti-CD33) (Ab175859). The ED₅₀ for this effect is 391.3 ng/mL.

Recombinant Human CD33 Protein (rp143966) - SDS-PAGE
3 μg/lane of Recombinant Human CD33 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 71.0 kDa under reducing conditions and 150.7 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0505375Certificate of AnalysisSep 10, 2026 rp143966
ZJ24F0505376Certificate of AnalysisSep 10, 2026 rp143966
ZJ24F0505377Certificate of AnalysisSep 10, 2026 rp143966
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.