Recombinant Human Complement Component C3a Protein

Cat. No.: rp183573

CALIDAD & PUREZA Carrier Free, PBS Only, ≥95%(SDS-PAGE)

Accession #

P01024

Protein Tag

No tag

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Testing in progress

Especificaciones

Product Name

Recombinant Human Complement Component C3a Protein

Sinónimos

AHUS5 | ARMD9 | ASP | C3a | C3b | Complement C3 | CPAMD1 | HEL-S-62p | Anaphylatoxin | C3 | Complement Component C3a

Grado

Carrier Free, PBS Only

Especificaciones y pureza

Carrier Free,PBS Only,≥95%(SDS-PAGE)

Mecanismos bioquímicos y fisiológicos

C3a is an anaphylotoxin polypeptide comprising amino acids (aa) 672-748 of the Complement C3 precursor protein. Anaphylatoxins are proteolytically generated from the C3, C4 and C5 alpha chains by convertases formed by other complement fragments. They shar

Bioactividad

Testing in progress

Concentración de endotoxinas

<1.0 EU/μg

Aminoácidos

672-748 aa

Secuencia

SVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLAR

Número de adhesión

P01024

Peso molecular previsto

9.1 kDa

SDS-PAGE

10.9 kDa, under reducing conditions; 11.3 kDa, under non-reducing conditions.

Tipo de molécula

Proteína

Product Line

Productos biológicos

Almacenamiento y envío

Reconstitución

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condiciones de almacenamiento de almacenamiento

Store at -20°C,Avoid repeated freezing and thawing

Enviado en

Ice chest + Ice pads

Estabilidad y almacenamiento

Store at -20°C for 1 year. Avoid freeze/thaw cycle.

Imágenes

SDS-PAGE: Recombinant Human Complement Component C3a Protein (rp183573)

Recombinant Human Complement Component C3a Protein (rp183573) - SDS-PAGE
3 μg/lane of Recombinant Human Complement Component C3a Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 10.9 kDa under reducing conditions and 11.3 kDa under non-reducing conditions.

Objetivos asociados (humanos)

C3 Tclin Complement C3 (0 Activities)

Discover Target: C3

Activity Type	Activity Value -log(M)	Mechanism of Action	Activity Reference	Publications (PubMed IDs)

Preguntas frecuentes

What is the purity of this product, and how is it determined?

This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

What does PBS Only mean?

PBS Only is a defined analytical purity tier suitable for workflows requiring a specific validated property. It specifies a minimum assay percentage, controlled limits on common impurities (water, heavy metals, residue on ignition), and lot-to-lot consistency. PBS Only is one of several purity tiers — choose based on the sensitivity and regulatory requirements of your method.

How should this product be stored?

Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.