Recombinant Human IL-28B/IFN-lambda 3 Protein, >95% (SDS-PAGE)

Cat. No.: rp169633

CALIDAD & PUREZA Animal Free, Carrier Free, Azide Free, His Tag, PBS Only, ≥95%(SDS-PAGE)

Accession #

Q8IZI9

Protein Tag

C-His

Expression system

HEK293

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Testing in progress

Descripción general

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
IL-28B (also named interferon-lambda 3, IFN-lambda 3), IL-28A (IFN-lambda 2) and IL-29 (IFN-lambda 1) are type III interferons that are class II cytokine receptor ligands. They are distantly related to members of the IL-10 family and type I IFN family. Human IL-28B cDNA encodes a 200 amino acid (aa) protein with a 25 aa signal peptide and a 175 aa mature protein that lacks N-glycosylation sites. Mature human IL-28B shares 64% and 75% aa sequence identity with mouse and canine IL-28B, respectively, and is active across species. Human IL-28B shares 94% and 69% aa identity with human IL-28A and IL‑29, respectively. Type III interferons are widely expressed, but are mainly produced by antigen presenting cells in response to viruses and double-stranded RNA that interact with Toll-like receptors or RIG-1 family helicases. They signal through a widely expressed receptor that is a heterodimer of the IL-10 receptor beta (IL-10 R beta ) and IL-28 receptor alpha (IL-28 R alpha ; also called IFN-lambda R1). Interaction of either type I or type III IFNs with their receptors activates similar pathways, including JAK tyrosine kinase activation, STAT phosphorylation and formation of the IFN-stimulated regulatory factor 3 (ISGF-3) transcription factor complex. Both type I and III IFNs induce anti‑viral activity and up‑regulate MHC class I antigen expression. Cell lines responsive to type III IFNs are also responsive to type I IFNs, but in general, higher concentrations of type III IFNs are needed for similar in vitro responses. In vivo, however, type III IFNs enhance levels of IFN-gamma in serum, suggesting that the robust anti-viral activity of type III IFNs may stem in part from activation of the immune system. Anti-proliferative and antitumor activity in vivo has also been shown for type III IFNs.

Especificaciones

Product Name

Recombinant Human IL-28B/IFN-lambda 3 Protein, >95% (SDS-PAGE)

Sinónimos

Cytokine Zcyto22 | IFN-lambda-3 | IFN-lambda-4 | IL-28B | IL-28C | IL28B | IL28B_HUMAN | IL28C | Interferon lambda-3 | Interferon lambda-4 | interleukin 28B (interferon, lambda 3) | Interleukin 28C | Interleukin-28B | Interleukin-28C | IFN-lambda 3

Grado

Animal Free, Azide Free, Carrier Free, His Tag, PBS Only

Especificaciones y pureza

Animal Free,Carrier Free,Azide Free,His Tag,PBS Only,≥95%(SDS-PAGE)

Pureza

>95% (SDS-PAGE)

Bioactividad

Testing in progress

Concentración de endotoxinas

<1.0 EU/μg

Sistema de expresión

HEK293

Aminoácidos

1-196 aa

Secuencia

MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCVHHHHHH

Etiqueta proteínica

C-His

Número de adhesión

Q8IZI9

Peso molecular previsto

20.5 kDa

SDS-PAGE

18.4-24.1 kDa, under reducing conditions

Tipo de molécula

Proteína

Product Line

Productos biológicos

Almacenamiento y envío

Forma

Lyophilized

Reconstitución

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condiciones de almacenamiento de almacenamiento

Store at -20°C,Avoid repeated freezing and thawing

Enviado en

Ice chest + Ice pads

Estabilidad y almacenamiento

Store at -20°C for 1 year. Avoid freeze/thaw cycle.

Imágenes

SDS-PAGE: Recombinant Human IL-28B/IFN-lambda 3 Protein (rp169633)

Recombinant Human IL-28B/IFN-lambda 3 Protein (rp169633) - SDS-PAGE
3 μg/lane of Recombinant Human IL-28B/IFN-lambda 3 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 18.4-24.1 kDa under reducing conditions.

Preguntas frecuentes

How should this product be stored?

Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.

What is the purity of this product, and how is it determined?

This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.

What does Animal Free mean?

Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.