Recombinant Human S100A9 Protein

Cat. No.: rp209720
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. ≥95%(SDS-PAGE)
Accession #
P06702
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human S100A9 Protein (rp209720) at 1.0 μg/mL can bind Recombinant Human S100A8 Protein (rp183594) with the EC50 of 189.6 ng/mL.
★
Size
Alemania (EU)
USA*
Price
Qty
10μg
rp209720-10μg
—
3 Disponible
69,33€
50μg
rp209720-50μg
—
2 Disponible
208,17€
100μg
rp209720-100μg
—
2 Disponible
338,33€
1mg
rp209720-1mg
Fabricado bajo pedido · 8–12 semanas
1.856,87€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free, Bioactive, ActiBioPure™, ≥95%(SDS-PAGE) ActiBioPure™,Bioactive,Carrier Free for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human S100A9 Protein
Sinónimos
CAGBMigration inhibitory factor-related protein 14 | Calgranulin B | calgranulin-B | Calprotectin L1H subunit | CFAGMRP-14,60B8AG | CGLB | L1AG | LIAG | MAC387 | MIF | MRP-14 | MRP14Leukocyte L1 complex heavy chain | NIF | P14 | protein S100-A9 | S100 cal
Grado
ActiBioPure™, Bioactive, Carrier Free
Especificaciones y pureza
Carrier Free, Bioactive, ActiBioPure™, ≥95%(SDS-PAGE)
Mecanismos bioquímicos y fisiológicos
S100A9, also known as MRP14 and Calgranulin B, is an approximately 14 kDa pro-inflammatory protein in the S100 family of calcium-binding proteins. It is up-regulated in neutrophils and monocytes at sites of inflammation (e.g., psoriasis, rheumatoid arthri
Bioactividad
Immobilized Recombinant Human S100A9 Protein (rp209720) at 1.0 μg/mL can bind Recombinant Human S100A8 Protein (rp183594) with the EC50 of 189.6 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
2-114 aa
Secuencia
TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Número de adhesión
Peso molecular previsto
13.1 kDa
SDS-PAGE
12.2 & 27.2 kDa, under reducing conditions; 12.2 & 27.2 kDa, under non-reducing conditions.
Tipo de molécula
Proteína
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human S100A9 Protein (rp209720) - Binding Activity
Immobilized Recombinant Human S100A9 Protein (rp209720) at 1.0 μg/mL can bind Recombinant Human S100A8 Protein (rp183594) with the EC50 of 189.6 ng/mL.

Recombinant Human S100A9 Protein (rp209720) - SDS-PAGE
3 μg/lane of Recombinant Human S100A9 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 12.2 & 27.2 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F1214679Certificate of AnalysisJul 15, 2026 rp209720
ZJ24F1214680Certificate of AnalysisJul 15, 2026 rp209720
ZJ24F1214681Certificate of AnalysisJul 15, 2026 rp209720
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Preguntas frecuentes

How should this product be stored?
Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.
How is this product shipped?
This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.
What is the purity of this product, and how is it determined?
This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.
What does Carrier Free mean?
Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
What does Bioactive mean?
Bioactive indicates that the product has been processed and tested for biological and biochemical applications. Specifications may include endotoxin limits, microbial controls, sterility, low DNase/RNase/protease activity, and verified biological activity where relevant.

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View Bioactive grade guide → View ActiBioPure™ grade guide →

Artículos relacionados

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.