Recombinant Human TCF3/E2A Protein

Cat. No.: rp231123

GRADE & PURITY Carrier Free, ≥95%(SDS-PAGE), See COA

Accession #

P15923

Protein Tag

No tag

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Specifications

Product Name

Recombinant Human TCF3/E2A Protein

Sinónimos

bHLHb21 | bHLHb21TCF-3 | Class B basic helix-loop-helix protein 21 | E2A immunoglobulin enhancer-binding factor E12/E47 | E2A | E2AKappa-E2-binding factor | Immunoglobulin enhancer-binding factor E12/E47 | Immunoglobulin transcription factor 1 | ITF1 | IT

Grado

Carrier Free

Especificaciones y pureza

Carrier Free,≥95%(SDS-PAGE),See COA

Mecanismos bioquímicos y fisiológicos

TCF-3, also known as E2A and ITF-1, is a member of the E protein homeobox family. TCF-3 regulates checkpoints that allow B lineage commitment and B and T cell receptor gene rearrangement. Two isoforms named E12 and E47 are alternatively spliced within the

Concentración de endotoxinas

<1.0 EU/μg

Aminoácidos

100-500 aa

Secuencia

GKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTYPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKRE

Número de adhesión

P15923

Peso molecular previsto

39.8 kDa

SDS-PAGE

41.2 kDa, under reducing conditions; 41.2 kDa, under non-reducing conditions.

Tipo de molécula

Proteína

Almacenamiento y envío

Concentración

See COA

Reconstitución

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condiciones de almacenamiento de almacenamiento

Store at -20°C,Avoid repeated freezing and thawing

Enviado en

Ice chest + Ice pads

Estabilidad y almacenamiento

Store at -20℃ for 6 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.

Imágenes

SDS-PAGE: Recombinant Human TCF3/E2A Protein (rp231123)

Recombinant Human TCF3/E2A Protein (rp231123) - SDS-PAGE 

3 μg/lane of Recombinant Human TCF3/E2A Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 41.2 kDa.

Preguntas frecuentes

What is the purity of this product, and how is it determined?

This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

How should this product be stored?

Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.