🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Structure A granel y personalizado
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

RFC4

DescripciónReplication factor C subunit 4

Gene and Protein Information

Gene ID5984
Uniprot Accession IDs P35249 B4DM41 D3DNV2 Q6FHX7
Ensembl ID ENSP00000376272
Symbol A1 RFC37
FamilyBelongs to the activator 1 small subunits family.
Sequence
MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp100609026RFC4replication factor C subunit 49598VGNC:2535OMA, EggNOG
Macaque100426721RFC4replication factor C subunit 49544Inparanoid, OMA, EggNOG
Mouse106344Rfc4replication factor C (activator 1) 410090MGI:2146571Inparanoid, OMA, EggNOG
Rat288003Rfc4replication factor C subunit 410116RGD:1310142Inparanoid, OMA, EggNOG
Dog478667RFC4replication factor C subunit 49615VGNC:45495Inparanoid, OMA, EggNOG
Horse100068189RFC4replication factor C subunit 49796VGNC:22321Inparanoid, OMA, EggNOG
Cow504637RFC4replication factor C subunit 49913VGNC:33888Inparanoid, OMA, EggNOG
Pig106504063RFC4replication factor C subunit 49823OMA, EggNOG
Opossum100016281RFC4replication factor C subunit 413616Inparanoid, OMA, EggNOG
Chicken424958RFC4replication factor C subunit 49031CGNC:6607Inparanoid, OMA
Anole lizard100561657rfc4replication factor C subunit 428377Inparanoid, OMA, EggNOG
Xenopus549117rfc4replication factor C subunit 48364XB-GENE-955724Inparanoid, OMA, EggNOG
Zebrafish406435rfc4replication factor C (activator 1) 47955ZDB-GENE-040824-3Inparanoid, OMA
C. elegans175976rfc-4Replication factor C subunit 46239Inparanoid, EggNOG
Fruitfly32763CG8142CG8142 gene product from transcript CG8142-RA7227FBgn0030871Inparanoid, EggNOG
S.cerevisiae853531RFC2replication factor C subunit 24932S000003829Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    DNA-directed DNA polymerase    /    Replication factor C subunit 4
protein    /    nucleic acid binding    /    nucleotidyltransferase    /    Replication factor C subunit 4
DTO Classes
protein    /    Enzyme    /    Transferase    /    Nucleotidyltransferase    /    Polymerase    /    DNA-directed DNA polymerase    /    Replication factor C subunit 4

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.