🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

MMP13

DescripciónCollagenase 3

Gene and Protein Information

Gene ID4322
Uniprot Accession IDs P45452 A8K846 B2RCZ3 Q6NWN6
Ensembl ID ENSP00000260302
Symbol CLG3 MDST MANDP1 MMP-13
FamilyBelongs to the peptidase M10A family.
Sequence
MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp451513MMP13matrix metallopeptidase 139598VGNC:1095OMA, EggNOG
Macaque703980MMP13matrix metallopeptidase 139544Inparanoid, OMA, EggNOG
Mouse17386Mmp13matrix metallopeptidase 1310090MGI:1340026Inparanoid, OMA, EggNOG
Rat171052Mmp13matrix metallopeptidase 1310116RGD:620196Inparanoid, OMA, EggNOG
Dog403763MMP13matrix metallopeptidase 139615VGNC:43276Inparanoid, OMA, EggNOG
Horse100009711MMP13matrix metallopeptidase 139796VGNC:49489Inparanoid, OMA, EggNOG
Cow281914MMP13matrix metallopeptidase 139913VGNC:31518Inparanoid, OMA, EggNOG
Pig397346MMP13matrix metallopeptidase 139823OMA, EggNOG
Opossum100012553MMP13matrix metallopeptidase 1313616Inparanoid, OMA, EggNOG
PlatypusMMP13matrix metallopeptidase 13 [Source:HGNC Symbol;Acc:HGNC:7159]9258OMA, EggNOG
Chicken395683MMP13matrix metallopeptidase 139031CGNC:49430Inparanoid, OMA
Anole lizard100552256mmp13matrix metallopeptidase 1328377Inparanoid, OMA
Xenopus100490019mmp13lmatrix metallopeptidase 13 (collagenase 3) like8364XB-GENE-481559Inparanoid, OMA
Zebrafish100006896mmp13bmatrix metallopeptidase 13b7955ZDB-GENE-030131-6152Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.