Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Microtubule-associated proteins 1A/1B light chain 3B |
|---|
Gene and Protein Information
| Gene ID | 81631 |
|---|---|
| Uniprot Accession IDs | Q9GZQ8 Q6NW02 |
| Ensembl ID | ENSP00000268607 |
| Symbol | MAP1ALC3 LC3B ATG8F MAP1LC3B-a MAP1A/1BLC3 |
| Family | Belongs to the ATG8 family. |
| Sequence | MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 746157 | MAP1LC3B | microtubule associated protein 1 light chain 3 beta | 9598 | Inparanoid, OMA, EggNOG | |
| Dog | 479619 | MAP1LC3B | microtubule associated protein 1 light chain 3 beta | 9615 | OMA, EggNOG | |
| Horse | 100060547 | LOC100060547 | microtubule-associated proteins 1A/1B light chain 3B | 9796 | OMA, EggNOG | |
| Cow | 408001 | MAP1LC3B | microtubule associated protein 1 light chain 3 beta | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100462754 | MAP1LC3B | microtubule associated protein 1 light chain 3 beta | 9823 | Inparanoid, OMA, EggNOG | |
| Xenopus | 394972 | map1lc3b | microtubule associated protein 1 light chain 3 beta | 8364 | XB-GENE-953620 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / cytoskeletal protein / non-motor microtubule binding protein / Microtubule-associated proteins 1A/1B light chain 3B
protein / cytoskeletal protein / non-motor microtubule binding protein / Microtubule-associated proteins 1A/1B light chain 3B
DTO Classes
protein / Cellular structure / Microtubule family cytoskeletal protein / Non-motor microtubule binding protein / Microtubule-associated proteins 1A/1B light chain 3B
protein / Cellular structure / Microtubule family cytoskeletal protein / Non-motor microtubule binding protein / Microtubule-associated proteins 1A/1B light chain 3B
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.