🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Structure A granel y personalizado
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

UNC119

DescripciónProtein unc-119 homolog A

Gene and Protein Information

Gene ID9094
Uniprot Accession IDs Q13432 A8K8G4 F1T095 O95126
Ensembl ID ENSP00000337040
Symbol RG4 HRG4 POC7 IMD13 POC7A
FamilyBelongs to the PDE6D/unc-119 family.
Sequence
MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp455028UNC119unc-119 lipid binding chaperone9598VGNC:9763OMA, EggNOG
Macaque716064UNC119unc-119 lipid binding chaperone9544OMA, EggNOG
Mouse22248Unc119unc-119 lipid binding chaperone10090MGI:1328357Inparanoid, OMA, EggNOG
Rat29402Unc119unc-119 lipid binding chaperone10116RGD:3942Inparanoid, OMA, EggNOG
Dog491169UNC119unc-119 lipid binding chaperone9615VGNC:48133Inparanoid, OMA, EggNOG
Horse100059151UNC119unc-119 lipid binding chaperone9796VGNC:24789Inparanoid, OMA, EggNOG
Cow538501UNC119unc-119 lipid binding chaperone9913VGNC:36662Inparanoid, OMA, EggNOG
PlatypusUNC119unc-119 lipid binding chaperone [Source:HGNC Symbol;Acc:HGNC:12565]9258OMA, EggNOG
Chicken771690UNC119unc-119 lipid binding chaperone9031CGNC:2670Inparanoid, OMA
Anole lizardUNC119unc-119 lipid binding chaperone [Source:HGNC Symbol;Acc:HGNC:12565]28377Inparanoid, OMA, EggNOG
Xenopus100127819unc119unc-119 lipid binding chaperone8364XB-GENE-954877Inparanoid, OMA, EggNOG
Zebrafish678653unc119bunc-119 homolog b (C. elegans)7955ZDB-GENE-050201-2OMA, EggNOG
C. elegans176519unc-119Protein unc-1196239OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.