🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Structure A granel y personalizado
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

ACMSD

Descripción2-amino-3-carboxymuconate-6-semialdehyde decarboxylase

Gene and Protein Information

Gene ID130013
Uniprot Accession IDs Q8TDX5 Q3B7X3 Q53SR5 Q96KY2
Ensembl ID ENSP00000348459
FamilyBelongs to the metallo-dependent hydrolases superfamily. ACMSD family.
Sequence
MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGLERKQFE
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp459627ACMSDaminocarboxymuconate semialdehyde decarboxylase9598VGNC:50OMA, EggNOG
Macaque708917ACMSDaminocarboxymuconate semialdehyde decarboxylase9544Inparanoid, OMA
Mouse266645Acmsdamino carboxymuconate semialdehyde decarboxylase10090MGI:2386323Inparanoid, OMA, EggNOG
Rat171385Acmsdaminocarboxymuconate semialdehyde decarboxylase10116RGD:620868Inparanoid, OMA
Dog476125ACMSDaminocarboxymuconate semialdehyde decarboxylase9615VGNC:37512Inparanoid, OMA, EggNOG
Horse100050432ACMSDaminocarboxymuconate semialdehyde decarboxylase9796VGNC:14984Inparanoid, OMA, EggNOG
Cow515030ACMSDaminocarboxymuconate semialdehyde decarboxylase9913VGNC:25544Inparanoid, OMA, EggNOG
Pig100154768ACMSDaminocarboxymuconate semialdehyde decarboxylase9823OMA, EggNOG
Opossum100015778ACMSDaminocarboxymuconate semialdehyde decarboxylase13616Inparanoid, OMA, EggNOG
PlatypusACMSDaminocarboxymuconate semialdehyde decarboxylase [Source:HGNC Symbol;Acc:HGNC:19288]9258OMA, EggNOG
Chicken424288ACMSDaminocarboxymuconate semialdehyde decarboxylase9031CGNC:9260Inparanoid, OMA, EggNOG
Anole lizard100551851acmsdaminocarboxymuconate semialdehyde decarboxylase28377Inparanoid, OMA, EggNOG
Xenopus100488272acmsdaminocarboxymuconate semialdehyde decarboxylase8364XB-GENE-962248Inparanoid, OMA, EggNOG
Zebrafish557166acmsdaminocarboxymuconate semialdehyde decarboxylase7955ZDB-GENE-070410-103Inparanoid, OMA, EggNOG
C. elegans175280acsd-12-amino-3-carboxymuconate-6-semialdehyde decarboxylase6239Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.