🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

SUB1

DescripciónActivated RNA polymerase II transcriptional coactivator p15

Gene and Protein Information

Gene ID10923
Uniprot Accession IDs P53999 Q96L29
Ensembl ID ENSP00000265073
Symbol PC4 RPO2TC1 P15 PC4 p14
FamilyBelongs to the transcriptional coactivator PC4 family.
Sequence
MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Mouse20024Sub1SUB1 homolog (S. cerevisiae)10090MGI:104811Inparanoid, OMA, EggNOG
Rat192269Sub1SUB1 homolog, transcriptional regulator10116RGD:621582Inparanoid, OMA, EggNOG
Dog479283SUB1SUB1 homolog, transcriptional regulator9615OMA, EggNOG
Horse100068496SUB1SUB1 homolog, transcriptional regulator9796VGNC:23741Inparanoid, OMA, EggNOG
Cow533984SUB1SUB1 homolog, transcriptional regulator9913VGNC:35454Inparanoid, OMA, EggNOG
Opossum100015659SUB1SUB1 homolog, transcriptional regulator13616Inparanoid, OMA, EggNOG
Platypus100092955SUB1SUB1 homolog, transcriptional regulator9258Inparanoid, OMA, EggNOG
Chicken427425SUB1SUB1 homolog, transcriptional regulator9031CGNC:2359Inparanoid, OMA, EggNOG
Anole lizard100563239sub1SUB1 homolog, transcriptional regulator28377Inparanoid, OMA, EggNOG
Xenopus448190sub1SUB1 homolog, transcriptional regulator8364XB-GENE-1015843Inparanoid, OMA, EggNOG
Zebrafish553561sub1aSUB1 homolog, transcriptional regulator a7955ZDB-GENE-050522-151Inparanoid, OMA
C. elegans188475T13F2.2Putative RNA polymerase II transcriptional coactivator6239Inparanoid, OMA
Fruitfly34120Ssb-c31aSingle stranded-binding protein c31A7227FBgn0015299Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.