🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Structure A granel y personalizado
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CLIC3

DescripciónChloride intracellular channel protein 3

Gene and Protein Information

Gene ID9022
Uniprot Accession IDs O95833 Q5SPZ7
Ensembl ID ENSP00000419378
FamilyBelongs to the chloride channel CLIC family.
Sequence
MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp464921CLIC3chloride intracellular channel 39598VGNC:13865OMA, EggNOG
Macaque721634CLIC3chloride intracellular channel 39544Inparanoid, OMA
Mouse69454Clic3chloride intracellular channel 310090MGI:1916704Inparanoid, OMA
Rat296566Clic3chloride intracellular channel 310116RGD:1307249Inparanoid, OMA
Dog607042CLIC3chloride intracellular channel 39615VGNC:39339Inparanoid, OMA, EggNOG
Horse100066181CLIC3chloride intracellular channel 39796VGNC:16612Inparanoid, OMA
Cow505436CLIC3chloride intracellular channel 39913VGNC:27441Inparanoid, OMA, EggNOG
Opossum100022461CLIC3chloride intracellular channel 313616Inparanoid, EggNOG
Platypus100083829CLIC3chloride intracellular channel 39258Inparanoid, OMA
Anole lizard103281557clic3chloride intracellular channel 328377Inparanoid, OMA
Xenopus447989clic3chloride intracellular channel 38364XB-GENE-959390Inparanoid, OMA, EggNOG
Zebrafish84040clic3chloride intracellular channel 37955ZDB-GENE-010507-2OMA, EggNOG

Protein Classes

DTO Classes
protein    /    Ion channel    /    Intracellular chloride channel (clic) family    /    Chloride intracellular channel protein 3

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.