🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

HDAC3

DescripciónHistone deacetylase 3

Gene and Protein Information

Gene ID8841
Uniprot Accession IDs O15379 D3DQE1 O43268 Q9UEI5 Q9UEV0 HD3
Ensembl ID ENSP00000302967
Symbol HD3 RPD3 KDAC3 RPD3-2
FamilyBelongs to the histone deacetylase family. HD type 1 subfamily.
Sequence
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp738624HDAC3histone deacetylase 39598VGNC:4032OMA, EggNOG
Macaque704467HDAC3histone deacetylase 39544Inparanoid, OMA, EggNOG
Mouse15183Hdac3histone deacetylase 310090MGI:1343091Inparanoid, OMA, EggNOG
Rat84578Hdac3histone deacetylase 310116RGD:619977Inparanoid, OMA
Dog478040HDAC3histone deacetylase 39615VGNC:50628Inparanoid, OMA, EggNOG
Horse100061405HDAC3histone deacetylase 39796VGNC:49121Inparanoid, OMA, EggNOG
Pig100511372HDAC3histone deacetylase 39823Inparanoid, OMA, EggNOG
Opossum100022921HDAC3histone deacetylase 313616Inparanoid, EggNOG
Chicken395506HDAC3histone deacetylase 39031CGNC:1896Inparanoid, OMA, EggNOG
Anole lizard100557493hdac3histone deacetylase 328377Inparanoid, OMA, EggNOG
Xenopus549637hdac3histone deacetylase 38364XB-GENE-481106Inparanoid, OMA, EggNOG
Zebrafish393965hdac3histone deacetylase 37955ZDB-GENE-040426-847Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    reductase    /    Histone deacetylase 3
protein    /    hydrolase    /    deacetylase    /    Histone deacetylase 3
protein    /    hydrolase    /    nucleic acid binding    /    Histone deacetylase 3
DTO Classes
protein    /    Epigenetic regulator    /    Eraser    /    Histone deacetylase    /    HDAC class I    /    Histone deacetylase 3

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.