🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Structure A granel y personalizado
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

MAGOH

DescripciónProtein mago nashi homolog

Gene and Protein Information

Gene ID4116
Uniprot Accession IDs P61326 B1ARP8 B2R5A2 O35169 P50606 Q5SW69
Ensembl ID ENSP00000360525
Symbol MAGOHA MAGOH1 MAGOHA
FamilyBelongs to the mago nashi family.
Sequence
MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp104001049MAGOHmago homolog, exon junction complex subunit9598VGNC:11529OMA, EggNOG
Macaque714261MAGOHmago homolog, exon junction complex core component9544Inparanoid, OMA, EggNOG
Mouse17149Magohmago homolog, exon junction complex core component10090MGI:1330312Inparanoid, OMA
Rat298385Magohmago homolog, exon junction complex core component10116RGD:1305174Inparanoid, OMA
Horse100060994MAGOHmago homolog, exon junction complex core component9796Inparanoid, OMA
Cow505417MAGOHmago homolog, exon junction complex core component9913Inparanoid, OMA
Xenopus100038130magohmago homolog, exon junction complex subunit8364XB-GENE-493540Inparanoid, OMA
C. elegans173073mag-1Protein mago nashi homolog6239Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.