Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Nucleolar GTP-binding protein 1 |
|---|
Gene and Protein Information
| Gene ID | 23560 |
|---|---|
| Uniprot Accession IDs | Q9BZE4 B3KMC5 B4DY13 B7Z7A3 O95446 Q5T3R8 Q9NVJ8 |
| Ensembl ID | ENSP00000354040 |
| Symbol | CRFG NOG1 NGB CRFG NOG1 |
| Family | Belongs to the TRAFAC class OBG-HflX-like GTPase superfamily. OBG GTPase family. NOG subfamily. |
| Sequence | MAHYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLSQILTDFPKLDDIHPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTVIKRQKQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVDVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEDRNTIEMQAITALAHLRAAVLYVMDLSEQCGHGLREQLELFQNIRPLFINKPLIVVANKCDVKRIAELSEDDQKIFTDLQSEGFPVIETSTLTEEGVIKVKTEACDRLLAHRVETKMKGNKVNEVLNRLHLAIPTRRDDKERPPFIPEGVVARRKRMETEESRKKRERDLELEMGDDYILDLQKYWDLMNLSEKHDKIPEIWEGHNIADYIDPAIMKKLEELEKEEELRTAAGEYDSVSESEDEEMLEIRQLAKQIREKKKLKILESKEKNTQGPRMPRTAKKVQRTVLEKEMRSLGVDMDDKDDAHYAVQARRSRSITRKRKREDSAPPSSVARSGSCSRTPRDVSGLRDVKMVKKAKTMMKNAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450261 | GTPBP4 | GTP binding protein 4 | 9598 | VGNC:4701 | Inparanoid, OMA, EggNOG |
| Macaque | 709873 | GTPBP4 | GTP binding protein 4 | 9544 | OMA, EggNOG | |
| Mouse | 69237 | Gtpbp4 | GTP binding protein 4 | 10090 | MGI:1916487 | Inparanoid, OMA, EggNOG |
| Rat | 114300 | Gtpbp4 | GTP binding protein 4 | 10116 | RGD:620783 | Inparanoid, OMA, EggNOG |
| Dog | 478021 | GTPBP4 | GTP binding protein 4 | 9615 | VGNC:49777 | Inparanoid, OMA, EggNOG |
| Horse | 100071237 | GTPBP4 | GTP binding protein 4 | 9796 | VGNC:18652 | Inparanoid, OMA, EggNOG |
| Cow | 524743 | GTPBP4 | GTP binding protein 4 | 9913 | VGNC:29710 | Inparanoid, OMA, EggNOG |
| Pig | 100625226 | GTPBP4 | GTP binding protein 4 | 9823 | Inparanoid, OMA | |
| Opossum | 100017256 | GTPBP4 | GTP binding protein 4 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 420458 | GTPBP4 | GTP binding protein 4 | 9031 | CGNC:5061 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100559003 | gtpbp4 | GTP binding protein 4 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 496593 | gtpbp4 | GTP binding protein 4 | 8364 | XB-GENE-962819 | Inparanoid, OMA, EggNOG |
| Zebrafish | 334050 | gtpbp4 | GTP binding protein 4 | 7955 | ZDB-GENE-030131-5982 | Inparanoid, OMA, EggNOG |
| C. elegans | 176863 | nog-1 | Nucleolar GTP-binding protein 1 | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 35963 | Non1 | Novel nucleolar protein 1 | 7227 | FBgn0028473 | Inparanoid, EggNOG |
| S.cerevisiae | 856012 | NOG1 | putative GTPase NOG1 | 4932 | S000006014 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.