Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Homeobox protein NANOG |
|---|
Gene and Protein Information
| Gene ID | 79923 |
|---|---|
| Uniprot Accession IDs | Q9H9S0 D3DUU4 Q2TTG0 Q6JZS5 |
| Ensembl ID | ENSP00000229307 |
| Family | Belongs to the Nanog homeobox family. |
| Sequence | MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 748301 | NANOG | Nanog homeobox | 9598 | Inparanoid, OMA, EggNOG | |
| Macaque | 715746 | NANOG | Nanog homeobox | 9544 | OMA, EggNOG | |
| Mouse | 71950 | Nanog | Nanog homeobox | 10090 | MGI:1919200 | OMA, EggNOG |
| Rat | 414065 | Nanog | Nanog homeobox | 10116 | RGD:1303178 | OMA, EggNOG |
| Horse | 100061006 | NANOG | Nanog homeobox | 9796 | OMA, EggNOG | |
| Cow | 538951 | NANOG | Nanog homeobox | 9913 | OMA, EggNOG | |
| Opossum | 100013584 | NANOG | Nanog homeobox | 13616 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA binding protein / Homeobox protein NANOG
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein NANOG
protein / nucleic acid binding / DNA binding protein / Homeobox protein NANOG
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein NANOG
DTO Classes
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein NANOG
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein NANOG
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.